KEGG   Ficedula albicollis (collared flycatcher): 101810002Help
Entry
101810002         CDS       T02815                                 

Gene name
TK1
Definition
(RefSeq) thymidine kinase 1
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
fab  Ficedula albicollis (collared flycatcher)
Pathway
fab00240  Pyrimidine metabolism
fab00983  Drug metabolism - other enzymes
fab01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fab00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    101810002 (TK1)
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    101810002 (TK1)
Enzymes [BR:fab01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     101810002 (TK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TK ATPase_2 AAA_14
Motif
Other DBs
NCBI-GeneID: 101810002
NCBI-ProteinID: XP_005056316
LinkDB All DBs
Position
18
AA seq 220 aa AA seqDB search
MNCLTVPGVHPGSPTRPRGQIQVIFGPMFSGKSTELMRRVRRFQLAQYRCLLVKYAKDTR
YSSSGVSTHDRSTMEALPAQLLHDVYKEALGAAVIGIDEGQFFPDIVEFCETMANTGKTV
IVAALDGTFQRKAFGSILNLVPLAESVVKLNAVCMECFREASYTKRLGAEREVEVIGGAD
KYQSVCRACYFLMRPQPENKENVPLGLRQLETAVPRKIFT
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgaactgcctgacggtgcccggtgtgcaccccggctcccccacccggccccgcgggcag
atacaggtgatcttcgggcccatgttctccgggaagagcacggagctcatgcggcgagtg
cgacggttccagctcgcccagtaccggtgcctgctggtgaagtacgccaaggacacgcgg
tacagctcctccggggtctccacacacgaccggagcaccatggaggccctgcccgctcag
ctcctccacgacgtgtacaaggaggcgctgggtgccgccgtcatcggcatcgatgagggc
cagttcttcccagacatcgtggagttctgcgagacaatggccaacactgggaaaaccgtc
attgttgctgctctggatgggactttccagagaaaggcctttgggagcatcctgaacctg
gtgccgctggcggagagcgtggtgaagctgaacgctgtgtgcatggagtgcttccgggag
gcctcctacaccaagcggctgggagcagagcgggaggttgaagtgattggaggagctgac
aagtaccagtctgtgtgccgagcctgctacttcctcatgcgaccgcagccagagaacaag
gagaacgtgcccctgggcctgaggcagctggagacagctgtgcctcgcaagatcttcact
tga

DBGET integrated database retrieval system