KEGG   Ficedula albicollis (collared flycatcher): 101810084
Entry
101810084         CDS       T02815                                 

Gene name
PTGER4
Definition
(RefSeq) prostaglandin E receptor 4
  KO
K04261  prostaglandin E receptor 4
Organism
fab  Ficedula albicollis (collared flycatcher)
Pathway
fab04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:fab00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101810084 (PTGER4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:fab04030]
    101810084 (PTGER4)
G protein-coupled receptors [BR:fab04030]
 Rhodopsin family
  Lipid
   Prostaglandin
    101810084 (PTGER4)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srx NdhL 7TM_GPCR_Srb TBPIP
Other DBs
NCBI-GeneID: 101810084
NCBI-ProteinID: XP_005060533
UniProt: U3JH44
LinkDB
Position
Z
AA seq 474 aa
MSFDPTTVPPANGSANGTAGGAEGGKPPTIPTVMFIFGVVGNLIAIVVLCKSRKEQKETT
FYTLVCGLAVTDLLGTCLVSPVTIATYLQNQWPGGAALCEYSSFILLFFGLSGLSIICAM
SIERYLAINHAYFYNHYVDKKLAGLTLFAIYASNVLFCALPSMGLGKSTLQYPCTWCFID
WRTNVSTHAAYSYMYAGFSSFLILVTVICNILVCVALIRMHRQFMRRTSLGTDTTSSRLS
DFRRRRSFRRMAGAEIQMVILLIATSLVVVICSIPLVVRVFVNQLYRPASVQDVRQNPDL
QAIRIASVNPILDPWIYILLRKTVLSKAIEKIKCLFCRIGGARRQHSGGNFNCVDGRRTS
SAISSQSPSFISRELREISSTSQTLLYPPELSESSVGGRALLPGPGASSAQSDTTSVRTL
RSSDTSDSSQGHDSESAFLVSETSPAGGASPAAKSGPLQVTFPTETLNLSEKCI
NT seq 1425 nt   +upstreamnt  +downstreamnt
atgtcgttcgaccccaccaccgtgccacctgcgaacggctccgccaacgggaccgccggc
ggggccgagggcgggaagccccccactatccccactgtcatgttcatcttcggcgtggtg
ggcaacctcatagccatcgtggtgctctgcaagtccaggaaggagcagaaggagaccact
ttctacacgctggtctgtggactggcagttacagatctcttggggacctgcctggtgagt
ccggtcacaatcgccacctacctgcagaaccagtggccaggaggagctgcgctgtgtgag
tacagctccttcatcctcctcttctttgggctctctggcctcagcattatctgtgccatg
tctatagagaggtacctggccatcaaccatgcctatttctacaaccattatgtagacaag
aagctggcagggctcacgctctttgccatctacgcttccaacgtgctgttctgcgccctc
cccagcatggggctcggcaaatctactttgcagtacccctgcacttggtgtttcatagac
tggcgaacaaacgtgtccacccatgcagcgtattcctacatgtacgcgggcttcagctcc
ttcctgatcctggtgactgtgatctgcaacatcctggtgtgcgtggctctcattcgcatg
caccgccagttcatgagacgcacgtctttgggaacagacaccacctccagccgtttatct
gactttcgcagacgccggagcttccgtcgaatggctggagcagaaatccagatggttatt
ctgctcattgccacttccctggtcgtggtcatctgctccattcctctggtggtccgtgtg
tttgtgaaccagctgtaccggccggcatcagtgcaagatgtcaggcaaaaccctgacctg
caagccatccgcattgcctcggtgaaccccattttggacccgtggatctacatcctcctc
cgcaagactgtgctcagcaaagccatcgagaagatcaaatgcctcttctgccgcattggg
ggcgctcggaggcagcactcggggggcaacttcaactgcgtggacgggcgcaggacctcc
tctgccatctccagccagtcgccctcgttcatctcccgcgagctgcgggagatcagcagc
acctcgcagacgctgctgtaccctccggagctgagcgagagcagcgtcgggggccgcgcg
ctgctgccggggcccggcgccagctcggcgcagtccgacaccacgtccgtaaggacgctg
cgcagctccgacacctccgattcctcacagggacacgactccgagagcgccttcctggtg
agcgaaaccagccctgctggcggggccagccctgcagccaagagtggccctctccaggtc
accttccccacagagacattgaatttgtcagaaaagtgcatatag

DBGET integrated database retrieval system