KEGG   Ficedula albicollis (collared flycatcher): 101811025
Entry
101811025         CDS       T02815                                 

Gene name
CDKN1A
Definition
(RefSeq) cyclin dependent kinase inhibitor 1A
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
fab  Ficedula albicollis (collared flycatcher)
Pathway
fab04012  ErbB signaling pathway
fab04068  FoxO signaling pathway
fab04110  Cell cycle
fab04115  p53 signaling pathway
fab04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:fab00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101811025 (CDKN1A)
   04068 FoxO signaling pathway
    101811025 (CDKN1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101811025 (CDKN1A)
   04115 p53 signaling pathway
    101811025 (CDKN1A)
   04218 Cellular senescence
    101811025 (CDKN1A)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 101811025
NCBI-ProteinID: XP_005059450
UniProt: U3JKS9
LinkDB
Position
26
AA seq 147 aa
MPLSQSRAGQTPCSSKVCRNLFGPVDHEQLQHDFEDKIRQQLEEAQQRWNFNFETETPLE
GPFKWERVLEAERPPQEVHSLVRAVVSSDSRSSLVHRVPPGRICPEESEQSSKVYKAGSL
QSLKRGQTTIKDFYSAKRRIVPARPRP
NT seq 444 nt   +upstreamnt  +downstreamnt
atgccgctgtcccagagcagggctgggcagaccccctgcagcagcaaggtgtgcaggaac
ctcttcggccctgtggaccacgagcagctccagcacgactttgaggacaagataaggcaa
cagctggaagaagctcagcagcgctggaacttcaactttgagacagagactcccttggaa
gggccgttcaagtgggagagggtcctggaggctgagcggccgccccaggaggttcacagc
ctggtcagggctgtcgtcagcagtgacagcaggagctccttggtccacagggtccccccc
gggaggatctgccctgaggagtctgagcagagctccaaggtgtacaaggctggttccctg
caaagcttgaaacgtgggcagaccaccatcaaagacttctacagtgccaagcgaaggatc
gtccctgcccggccccggccgtga

DBGET integrated database retrieval system