KEGG   Ficedula albicollis (collared flycatcher): 101811401Help
Entry
101811401         CDS       T02815                                 

Gene name
SBK1
Definition
(RefSeq) SH3 domain binding kinase 1
  KO
K08858  serine/threonine-protein kinase SBK [EC:2.7.11.1]
Organism
fab  Ficedula albicollis (collared flycatcher)
Brite
KEGG Orthology (KO) [BR:fab00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fab01001]
    101811401 (SBK1)
Enzymes [BR:fab01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101811401 (SBK1)
Protein kinases [BR:fab01001]
 Serine/threonine kinases: Other
  NKF1 family
   101811401 (SBK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Kdo APH Pox_ser-thr_kin Cys_Knot_tox
Motif
Other DBs
NCBI-GeneID: 101811401
NCBI-ProteinID: XP_005054367
LinkDB All DBs
Position
14
AA seq 385 aa AA seqDB search
MDSFCFVCFQKEELQPLHLHSAAMSAGSIEQEPSRKLGCCGVPLITEDMQSLAIRTLSGT
DITKHYDLIRELGKGTYGKVDLVSHKSTGTKMALKFVNKSKTKLKNFLREFSITNTLSSS
PFIIKVFDVVFETEDCYVFAQEYAPGGDLFDIIPPQVGLPEELVKRCVQQLGLALDYMHS
KSLVHRDIKPENVLLFDRDCRRVKLADFGMTRKVGCRVKRISGTIPYTAPEVCQAGRAEG
FAVDTSIDVWAFGVLIFCVLTGNFPWEAAVASDAFFEEFVRWQKGRLAGLPSQWRRFTDS
ALRMFQRLLALDPEKRCPVKEVFYFIKCDLMAEVRCRPSYRSRKHARDKLPAGPHCHEPG
ASCTPAPLKRTVLTEASAARGPEPG
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atggattccttctgcttcgtctgcttccagaaagaggagctgcagcccctgcacctgcac
agcgcagccatgagcgcgggctcgattgagcaggagccgtcgcgcaagctgggctgctgc
ggggtgcccctgatcaccgaggacatgcagtccctggccatccgcacgctctcgggcacc
gacatcaccaagcactacgacctcatccgcgagctcggcaagggcacctacggcaaggtg
gacctggtgtcccacaaaagcacaggcaccaagatggccctgaagttcgtcaacaagagc
aagacgaagctgaagaacttcctgcgggagttcagcatcaccaacacgctctcctccagc
cccttcatcatcaaggtcttcgacgtggtctttgagaccgaggactgctacgtctttgct
caggagtacgcccctggtggggacctcttcgacatcatcccgcctcaggtggggctcccc
gaggagctggtgaagcgctgcgtgcagcagctgggcctggccctggactacatgcacagc
aagagcctggtgcaccgggacatcaaacccgagaacgtgctgctcttcgaccgcgactgc
cgccgcgtcaagctggcggatttcggcatgacccgcaaggtgggctgccgggtcaagcgc
atcagcggcaccatcccctacacggcgcccgaggtgtgccaggccggccgcgccgagggc
ttcgccgtggacaccagcatcgacgtctgggctttcggggtgctcatcttctgcgtcctc
accggcaacttcccctgggaggcggcggtggcgtccgacgccttcttcgaggagtttgtg
cggtggcagaaggggcggctggcggggctgccctcgcagtggcggcgcttcacggacagc
gccctgcggatgttccagcgcctgctggccctggaccccgagaagcgctgccccgtcaag
gaggttttctacttcatcaagtgcgacctcatggccgaggtgcgctgccggccctcgtac
cgctcccgcaagcacgccagggacaagctgccggccgggccgcactgccacgagcccggc
gcctcctgcacccccgccccgctcaagaggaccgtcctgaccgaggcgagcgcggcgcgc
ggccccgagcccggg

DBGET integrated database retrieval system