KEGG   Ficedula albicollis (collared flycatcher): 101811752Help
Entry
101811752         CDS       T02815                                 

Gene name
PFKP
Definition
(RefSeq) phosphofructokinase, platelet
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
fab  Ficedula albicollis (collared flycatcher)
Pathway
fab00010  Glycolysis / Gluconeogenesis
fab00030  Pentose phosphate pathway
fab00051  Fructose and mannose metabolism
fab00052  Galactose metabolism
fab01100  Metabolic pathways
fab01200  Carbon metabolism
fab01230  Biosynthesis of amino acids
fab03018  RNA degradation
Module
fab_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:fab00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    101811752 (PFKP)
   00030 Pentose phosphate pathway
    101811752 (PFKP)
   00051 Fructose and mannose metabolism
    101811752 (PFKP)
   00052 Galactose metabolism
    101811752 (PFKP)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    101811752 (PFKP)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:fab01009]
    101811752 (PFKP)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:fab03019]
    101811752 (PFKP)
Enzymes [BR:fab01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     101811752 (PFKP)
Protein phosphatases and associated proteins [BR:fab01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     101811752 (PFKP)
Messenger RNA biogenesis [BR:fab03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     101811752 (PFKP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 101811752
NCBI-ProteinID: XP_005040660
LinkDB All DBs
Position
2
AA seq 785 aa AA seqDB search
MDHQPKFFENLSGAGKAIAVLTSGGDAQGMNAAVRAVVRMGIYVNAKVYFIYEGYQGMVD
GGDNIVEVSWESVSSILQVGGTVIGSARCKPFRTREGRLQAALNLVQRGITNLCVIGGDG
SLTGANLFREEWSGLLEELAQKGKIDAEAVKKYAYLNIVGMVGSIDNDFCGTDMTIGTDS
ALHRIIEVVDAIMTTAQSHQRTFVLEVMGRHCGYLALVSALACGADWVFIPEYPPEEGWE
DTMCVKLSENRARKKRLNIIIVAEGAIDCHNKPITSEKVKDLVVQRLGFDTRVTILGHVQ
RGGTPSAFDRILASRMGVEAVLALLEATPDTPACVVSLSGNQAVRLPLMECVQMTQAVQK
AMDEGRFLEAVKLRGRSFENNLNTYKLLSHKKPDAELPKTNFNVAVLNVGAPAAGMNAAV
RAAVRVGMTEGHKIFAVIDGFEGFARGKIKEISWGDVGGWTGQGGSILGTKRTLPAKYLE
KIADQMRTNNINALMVIGGFEAYLGLLELSAAREKYDEFCVPMVMVPATVSNNVPGSDFS
IGADTALNTITDTCDRIKQSASGTKRRVFIIETMGGYCGYLANMGALAAGADAAYIFEEQ
FDIRELQANVEHLTEKMKTSIQRGLVLRNENCNENYTTDFIYQLYSEEGKGVFDCRKNVL
GHMQQGGAPSPFDRNFGTKISAKAMQWISKKLKETYRKEGGKVFANTDDSVCLLGMRRRN
LVFQPVAELKSETDFVHRIPKEQWWLKLRPLMKILAKYKTSYDVSDSGQLEHVAMLPKEA
ETGAI
NT seq 2358 nt NT seq  +upstreamnt  +downstreamnt
atggatcaccagcccaagttcttcgagaacctctcgggcgccgggaaggccatcgcggtg
ttgaccagcggcggcgatgcccaaggtatgaatgctgctgtgcgcgcagtagtacgcatg
ggaatctatgtaaatgccaaagtctattttatttatgagggttaccagggaatggttgat
ggaggtgataatattgtagaagtttcatgggaaagtgtttcaagtatcctgcaagtggga
ggcactgtgatcggcagcgcgcgctgcaaacccttccgcacgcgcgagggccgcctgcag
gccgccctcaacctggtgcagcggggcatcaccaacctgtgcgtgatcggcggcgacggc
agcctcaccggggccaacctcttccgcgaggagtggagcgggctgctggaggagctggcg
cagaaaggaaagattgatgcagaggctgttaagaagtatgcttaccttaacattgtgggc
atggttggatccatagacaatgacttctgtggcactgatatgaccattggtactgactca
gctctgcacagaataattgaagttgtggatgccatcatgaccactgctcagagccatcag
aggacatttgttctggaagttatggggcgacactgtgggtacctagctctggttagtgcc
ttagcctgtggtgcagattgggtgtttattcccgaatacccaccagaagaaggctgggaa
gacacaatgtgtgttaagctttcagagaaccgtgcacgaaagaaaaggctgaatattatt
attgtagctgaaggagccattgattgtcacaacaaacctataacatcagagaaggttaag
gatcttgtggttcagcggcttggttttgacacccgagtgaccatcctgggtcatgtgcaa
agaggtggaaccccttcagcttttgacagaattcttgccagtcgtatgggtgtggaagct
gtgcttgcccttttagaagctactccagatacccctgcctgtgttgtgtccctgtctgga
aaccaggctgtccgtctgcctctgatggagtgtgtgcagatgactcaagcggtccagaaa
gccatggatgagggaagatttcttgaggctgtgaagcttcgtggaaggagctttgaaaac
aaccttaacacatacaaattactgtcacacaaaaagccagatgctgagcttccaaagact
aattttaacgtggcagttttaaatgttggtgctcctgcagctggaatgaacgccgcagtg
agggctgcagtgagagttggcatgactgaaggtcacaaaatctttgctgtcatcgatggt
tttgaagggttcgctagagggaagattaaggaaatttcctggggagatgttggaggctgg
actggtcaaggaggatcaattcttggtacaaaacgtactcttcctgcaaaatacttggag
aagattgctgaccagatgcgcactaacaacattaacgcccttatggttattggtggattt
gaggcttaccttggacttctggaattgtcagctgcccgggagaaatatgacgaattctgt
gttccaatggttatggttcctgcaactgtatccaataatgtaccgggttcagatttcagc
attggtgcagatactgctctgaacactataactgatacgtgtgaccgcatcaagcagtcg
gccagcggcaccaagcgccgcgtgttcatcatcgagaccatgggcggctactgcggctac
ctggccaacatgggggccctggcagcaggagctgatgctgcctacatcttcgaggagcag
tttgatatcagagagctccaggctaatgtggaacacttgactgaaaaaatgaaaaccagt
atccagcgtggtctagtgctgcgaaatgagaactgcaatgagaactacaccactgatttc
atttatcagctgtattctgaagagggaaaaggagtgtttgactgtagaaaaaatgtattg
ggccatatgcagcagggtggagcaccttcaccatttgatagaaattttgggacaaaaatt
tcagcaaaagctatgcagtggatctccaaaaaactgaaagaaacctaccggaaagaagga
ggaaaagtatttgccaacacggatgactcagtctgtttgctgggaatgcggagacgcaac
cttgttttccaacccgtggctgagctcaagagcgaaacagactttgtacacaggattccc
aaggagcagtggtggctgaagctgcgaccactgatgaagatcctggccaagtacaagacc
agctacgatgtgtcagactcaggccagctggaacacgtggccatgctcccaaaggaagct
gagacaggagccatctaa

DBGET integrated database retrieval system