KEGG   Ficedula albicollis (collared flycatcher): 101811953
Entry
101811953         CDS       T02815                                 

Gene name
CDKN1B
Definition
(RefSeq) cyclin dependent kinase inhibitor 1B
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
fab  Ficedula albicollis (collared flycatcher)
Pathway
fab04012  ErbB signaling pathway
fab04068  FoxO signaling pathway
fab04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:fab00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101811953 (CDKN1B)
   04068 FoxO signaling pathway
    101811953 (CDKN1B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101811953 (CDKN1B)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 101811953
NCBI-ProteinID: XP_005040214
UniProt: U3JPX2
LinkDB
Position
1A
AA seq 198 aa
MSNVRISNGSPTLERMEARQSEYPKPSACRNLFGPVNHEELNRELKKHLQEMEEAYQRKW
NFDFQNHRPLEGRYEWQAVEKGSSPDFYFRPPRLRKAVCKSAGRQSLDVNGNCQSVVFVG
SQGISEDTHCVAQKTDVSENQTDLAEQCTAQRKRPAADDSSPQNKKANTTEEEVSEDSPS
ASSVEQTPKKSSPGRHQT
NT seq 597 nt   +upstreamnt  +downstreamnt
atgtcaaacgtccgcatttctaatgggagccctaccctggagcgcatggaggccaggcag
tcggagtacccgaagccgtcagcgtgcaggaacctcttcgggccggtgaaccacgaagag
ctcaacagggagctgaagaaacacctgcaggagatggaggaggcgtaccagaggaagtgg
aatttcgatttccagaatcacaggccgctggaaggcaggtacgagtggcaagccgtggag
aaggggagctcgcccgacttctacttcagacccccccggctaaggaaagccgtctgcaag
tccgccggccgccagagcttggatgtaaatgggaattgccaaagcgtggtttttgtcggt
tctcagggaatctcagaggacactcactgtgtagctcaaaagactgatgtttcagaaaat
cagacggacttagcagagcagtgcactgcccagaggaaaagacccgcggccgatgattcc
tctcctcaaaataaaaaagccaacacaacagaagaagaggtttcagaagactcccccagt
gccagttcagtggagcaaacacccaagaaatcaagcccgggaagacatcaaacgtaa

DBGET integrated database retrieval system