KEGG   Ficedula albicollis (collared flycatcher): 101812108Help
Entry
101812108         CDS       T02815                                 

Gene name
RET
Definition
(RefSeq) ret proto-oncogene
  KO
K05126  proto-oncogene tyrosine-protein kinase Ret [EC:2.7.10.1]
Organism
fab  Ficedula albicollis (collared flycatcher)
Brite
KEGG Orthology (KO) [BR:fab00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fab01001]
    101812108 (RET)
Enzymes [BR:fab01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     101812108 (RET)
Protein kinases [BR:fab01001]
 Receptor tyrosine kinases (RTK)
  RET family
   101812108 (RET)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr RET_CLD3 Pkinase RET_CLD1 RET_CLD4 Cadherin Cadherin_2 RIO1 Pkinase_fungal Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 101812108
NCBI-ProteinID: XP_005048669
LinkDB All DBs
Position
6
AA seq 1124 aa AA seqDB search
MLQMPVNYDAFHYKGVNCTLAWHSEACRFQPLCFCCFREVALGLYFPRKEYLENVYIDEP
AGMPLLRIHALKDSPEEVAHFHLCQNLIISRGRHENNWFQIKEKSGVLYLSKSLDREDFN
MLSVGNWKPLPKVMLYVHPFQEKECDSTTRTTVFLSLINGTAPACSSLTARQLCFTEMDL
SFHIKENKPPGVFHQLQLPSVRHLCQNLSISYKLIAAEGVPFRYNGNSTAVWVTQRLDRE
ERERYELIAKCTVREGLREMQVEVPFLVNVLDEDDSPPFLPNGTDTAEAVVEFNRKEGTV
ISTLTVYDADTTPIYPLESSRKKYTGTIITDDPWISETFRVEHIFDEIHFSPNGSQVRGT
RHEYKLVLNKSISVTEHRSFQLDVLVNDTEFHGPERSVMLHFNVSILPVSIQFSNITYQF
TVNRNAERFAQIGKICIENCMKFRGVNITYKLLSPNASCYPVSIQQGREDKYGSLYVNDS
SALRRPECREMQYTVQATDRQSRKHTKTLLTVVLEGTLLKKEEDCPDSCAISKHRGECEE
CGGLGVLTGRCQWRQGSGKGITTNYSTCTPSIKTCPDGVCDAVESRDPAVCPQDCTSGNI
IGGHGKGIGNLGIKSGHGICYCFPRQNCYCEKDDIKEQLCDDLCKTVITGAVVLCFVISV
LVSYYCIHRYHKNSPKAPIASAEMTFRRPAQSYPISYSSSNVRRPSLDSVENQVSVDTFK
IPEDPKWEFPRKNLVLGKTLGEGEFGKVVKATAFRLKGRAGYTTVAVKMLKENASQSELR
DLLSEFNLLKQVNHPHVIKLYGACSQDGPLYLIVEYAKYGSLRSFLRESRKVGPSYMGSD
GNRNSSYLDNPDERALTMGDLISFAWQISRGMQYLAEMKLVHRDLAARNVLVAEGRKMKI
SDFGLSRDVYEEDSYVKRSKGRIPVKWMAIESLFDHIYTTQSDVWSFGVLLWEIVTLGGN
PYPGIAPERLFNLLKTGYRMERPENCSEEMYNLMLRCWKQEPDKRPTFTEISKELEKMMV
KSRDYLDLAASTPSDSLLYDDGLSEEETPLVDCNNAPLPRTLPSTWIENKLYGMSYPNWP
EESPVPLTRFDGTNSVFSRYANDSVYANWMVSHSAAKFMDKFDS
NT seq 3375 nt NT seq  +upstreamnt  +downstreamnt
atgctgcagatgcccgtgaattatgatgcctttcattacaagggggtgaattgcacatta
gcctggcattcagaagcctgcaggtttcagccactgtgcttttgctgtttcagagaggtg
gccctgggtctgtacttccccaggaaggagtacttggagaatgtgtacattgacgagcca
gcaggaatgcctctcctgcgcatccatgccctgaaggattcacctgaggaagtggcccac
ttccatctgtgccagaatctcataatttctcgaggaagacatgaaaataattggttccaa
atcaaagaaaaatcaggagttctctacctcagtaaaagcctggatagagaggactttaac
atgctgtctgttggaaattggaagccattacccaaggtgatgctgtatgtccaccctttc
caagagaaggaatgtgactccactacacgcaccacggttttcctctctttgatcaatggt
actgcaccagcttgcagttccctgacagcaaggcagctgtgcttcacagaaatggatctc
tcctttcacatcaaggagaataaaccacctggtgtatttcatcagctccagttaccctca
gttcgtcatctgtgtcagaatctcagcatttcctacaaattgattgcagccgaaggtgtc
ccctttcggtacaacgggaactccacggccgtgtgggtgacgcagcgcctggaccgggag
gagcgggagcgatacgagctcatcgccaagtgcaccgtcagagaggggctccgggagatg
caggtggaggtgcctttcctggtgaacgtgctggatgaagatgactctcctcccttcctt
cccaatggcactgatactgcagaggctgtcgtggagttcaacaggaaggagggcactgtt
atttccacgctgactgtgtacgatgcagacaccacgcctatttatccccttgaaagcagc
aggaagaaatacacaggaaccatcatcactgacgatccctggataagtgaaacatttcgt
gtagagcacatctttgatgaaatccacttcagcccaaatggcagccaagtgaggggaact
cgacatgaatacaaactggtactgaataaaagcatttcagtcacagagcatcgttccttc
cagctggatgttttggtgaatgacacagaatttcatggcccagagagatcagtgatgctt
catttcaatgtctccatcctccctgtcagcattcagttttcaaacataacttaccagttc
acagtgaacagaaatgctgaacgctttgcacagatcggaaagatctgcattgaaaactgc
atgaaattccgtggtgtgaacatcacctacaagctgctgtcccccaatgccagctgctat
cctgtcagcatccagcagggccgagaagacaagtatgggagcctctatgtgaacgattcc
tctgcgctgcgcagacccgagtgcagggagatgcagtacactgtgcaagctacggacagg
cagagcaggaaacacaccaaaaccctcctcactgttgtcctggaagggactcttttaaaa
aaagaagaggactgccctgactcttgtgctataagtaagcaccgtggtgaatgtgaagag
tgtggtggcctgggagtgttaacaggaagatgccagtggagacaggggagtgggaaaggg
atcaccacaaactattccacgtgcaccccgagcatcaagacttgtccggacggcgtctgc
gatgcagtggagagcagagacccggctgtgtgcccccaggactgcacaagtggaaacatt
attggtggccatgggaagggcattggaaatcttggaattaagtcaggacatgggatttgt
tactgcttcccaagacagaactgttactgtgagaaagatgatatcaaagagcaactgtgt
gacgacctgtgcaagactgtgatcacgggggcagtggtgctgtgctttgtcatctccgtg
ctggtttcctactattgcatccaccgttaccacaagaactccccgaaggcgcccatcgcc
tctgcggaaatgaccttccggcgcccggcgcagtcctaccccatcagctactcctccagc
aacgtgcgccgcccctccctggactccgtggagaaccaggtctccgtggacaccttcaaa
ataccagaagatccaaagtgggaattccctcggaagaacctagttctgggcaagactctt
ggagaaggagagtttggaaaggttgtcaaggcgacagcgttccgactcaagggaagagct
ggctataccactgtggcagtgaaaatgttaaaagaaaatgcttcccagagtgagctgcga
gatctcctgtcagagttcaacctgctgaaacaagtcaaccatcctcatgtcatcaaactt
tacggagcctgcagtcaagatggcccactgtatttaattgtggaatacgccaaatacggc
tccttgcgcagtttcctcagggaaagccggaaagtgggcccgagctacatgggcagtgat
ggcaacaggaactccagttacctggataaccccgatgagagagccctgaccatgggagac
ctgatatcgtttgcgtggcagatctcccgagggatgcagtaccttgcagagatgaagctt
gtgcatcgggatttagcagccaggaatgtgctggtggcagaagggcgcaaaatgaagatt
tctgattttggcctctcacgagatgtatatgaggaggattcgtatgtaaagaggagcaag
ggtcgaatccctgtgaagtggatggccatagagtcactatttgaccatatctacacaaca
caaagtgatgtatggtcatttggagttctgctgtgggagattgttactttaggaggcaat
ccttaccctggtattgctcctgaaagactcttcaacctcctaaaaacaggctatagaatg
gagagaccagaaaactgcagtgaggaaatgtacaacctcatgttgcgctgttggaagcaa
gaacctgataaaagaccaacatttactgagatcagcaaggaactagagaagatgatggtg
aagagtagggactacttagaccttgcagcttccacaccctctgactccttactgtacgat
gatgggctctcagaagaggagacacctctcgtggactgtaataatgctcccctccctcga
accctcccttccacatggattgaaaacaaactctatggcatgtcatacccgaactggcct
gaggagagccccgttccactcacaagattcgatggcactaactctgtgttttcaagatat
gcaaatgatagtgtatatgctaactggatggtttcacactcagcggcaaaatttatggac
aagtttgatagctaa

DBGET integrated database retrieval system