KEGG   Ficedula albicollis (collared flycatcher): 101813282Help
Entry
101813282         CDS       T02815                                 

Gene name
STK17A
Definition
(RefSeq) serine/threonine kinase 17a
  KO
K08804  serine/threonine kinase 17 [EC:2.7.11.1]
Organism
fab  Ficedula albicollis (collared flycatcher)
Brite
KEGG Orthology (KO) [BR:fab00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fab01001]
    101813282 (STK17A)
Enzymes [BR:fab01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101813282 (STK17A)
Protein kinases [BR:fab01001]
 Serine/threonine kinases: CAMK group
  DAPK family
   101813282 (STK17A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Kdo SPOUT_MTase_2 APH RIO1 Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 101813282
NCBI-ProteinID: XP_016161739
LinkDB All DBs
Position
2
AA seq 403 aa AA seqDB search
MSPDKKPPPGRSRGDRPPPPRSRQRGGLLAEIRTPIRTEPFQERYSLSPGRELGRGKFAV
VKKCIQKDTEKEFAAKFMRKRRKGQDCRMEIIHEIAVLELAQCNLWVINLHEVYETATEM
ILVLEYAAGGEIFDQCVAEREEAFKEKDVKRLMKQILEGVSFLHRNNVVHLDLKPQNILL
TSKSPLGDVKIVDFGLSRIMKSSEELREIMGTPEYVAPEILSYDPISTATDMWSIGVLAY
VMLTGISPFLGDDKQETFLNISQMNVSYSGEDFDLVSESAVDFIKTLLVKKPEDRATAEE
CLQHPWLEQSDNPACRAWNKSTEGETSDTIQKDADSASEQLVDAEKTGEEESIVTEELIV
VASYTLGQCRQSEKEKATEQKAISKRFKFEEPLLQEIPGEFIY
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgagccccgacaagaagccgccgcccggtcgctcccgcggtgaccgccccccccccccc
cgatcccggcagcgcggcgggctcctggcggagatccgcacgcccatccgcacggagccc
ttccaggagcggtacagcctcagccccggccgggagctcggcaggggaaaatttgcagtg
gtgaagaagtgtatccagaaagacactgaaaaagagtttgcagcaaaattcatgagaaaa
agaagaaagggccaagactgtcggatggaaataatccacgaaattgcagtcctcgagctg
gcacaatgcaacctttgggtcattaacttgcatgaagtttatgaaactgcgacagagatg
attttagtcctggaatatgctgctggaggtgaaatctttgaccaatgtgtggctgaaaga
gaggaggccttcaaagaaaaagatgttaagcgacttatgaagcagatattagaaggagtt
tcattcttgcacagaaacaatgttgttcatcttgacttaaagccccaaaatattctgcta
accagtaagtctcctctgggagatgttaagatagtggattttggcctttccagaataatg
aagagcagtgaggaactaagagaaatcatgggaactccagaatatgtagctcctgaaatt
ctgagttatgacccaatcagtacagcaactgatatgtggagcattggagtactggcatat
gttatgctaacagggatatcacctttcttgggggatgataaacaagaaacattcttaaac
atatctcaaatgaacgtaagttactctggagaggactttgaccttgtatcagagtctgct
gtggatttcatcaaaactctgctggttaagaaacccgaggaccgagcaacagctgaagaa
tgtcttcaacatccatggttagaacaaagtgataatcccgcttgcagggcctggaataag
agtacagaaggggagaccagtgataccatccagaaagatgcagattctgcctctgaacaa
ttagtagatgctgagaagacaggagaggaagaatcaatagtgactgaagaactaattgta
gtggcttcatacacactgggacaatgcaggcagtcagaaaaagaaaaagcaactgagcag
aaagccatttccaaacgatttaaatttgaggaaccattactgcaggaaataccaggagaa
ttcatttactga

DBGET integrated database retrieval system