KEGG   Ficedula albicollis (collared flycatcher): 101813386Help
Entry
101813386         CDS       T02815                                 

Gene name
MAP3K14
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 14
  KO
K04466  mitogen-activated protein kinase kinase kinase 14 [EC:2.7.11.25]
Organism
fab  Ficedula albicollis (collared flycatcher)
Pathway
fab04010  MAPK signaling pathway
fab04210  Apoptosis
fab04625  C-type lectin receptor signaling pathway
fab04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:fab00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101813386 (MAP3K14)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    101813386 (MAP3K14)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    101813386 (MAP3K14)
   04672 Intestinal immune network for IgA production
    101813386 (MAP3K14)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fab01001]
    101813386 (MAP3K14)
Enzymes [BR:fab01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     101813386 (MAP3K14)
Protein kinases [BR:fab01001]
 Serine/threonine kinases: STE group
  Other
   101813386 (MAP3K14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal Kdo
Motif
Other DBs
NCBI-GeneID: 101813386
NCBI-ProteinID: XP_005059643
UniProt: U3K4P2
LinkDB All DBs
Position
27
AA seq 941 aa AA seqDB search
MAVMGIACQGAPDPAIKHKKELTAAEGLKETVSEKQSSVCKVKVEDSKKVIFHSQWKILN
DVITKGTAKEETEGGCASISIIAQAECENSQEFSPTLSERSFIAHSKRYSSRSDSLDHIP
NNVAHATEGRMAPTWRGRHRGRARKKRHKKRSKLKGLPVAAGRRSPRTPEQESCTPIPVQ
EDESHQSTLYRNSFWVPEFNKDLGYDPLSFEKPAHASSSMCKLHSQRSQYKTELHKLISP
IQCLNHVWKQRDTVPQPETLHPFPYNILPPHFPHVDNPLHTMKQKVLDTYFHGDLNYQDS
HLSSLNLEYNFTKCINQSVQTSSDKLSVEEYLVDALKGSVSFGEPQNLASLAKTWRGGGL
ELKEHFHEESENEGVLLNEKLKPVDYEYREEVHWTKCPGSLGIGSFGEVYKIEDKQTGFQ
CAAKKVQVEHFRAEELTTCAAVASPSVVPLYGAVKEGPWVTIFMKLMEGGSLGQLIKQSG
CLPEDRALSYLGQVLEGLEYLHAQNILHGDVKAENVLLSADGSRALLCDFGHSAHLHPDG
LGKCLVTGNYVPGTETHMAPEVVMGKRCDSKVDVWSSCCMMLHMLNGCHPWTQYYNHPLC
LKIAKEPPPLREIPPSCNPLTAEIIKLGLEKEPLHRASASELKTKTSVALEEVGGVRSPW
KGEYREPRHLSLSKENSAQTSLSPTVSPVSETASDPNLSVKVSCASPVLPPPSLEQTEEV
EGSHWNEGKELPETCDPSPLSSTPLPLKTCSHVERATTISEQELQQLEIELFLNSLSQPY
SLEEQEQMLSCLSIDSPFVSDASERNSMKASHSLRDTMSSGIHSWNSQAEGQSCSWNNLL
SRSRHTDTPSYFNGVKIQIQLLSGENLHIRDFHRTKVGDIATGISSQIPVPAFSLVTKEG
QPVHYDMEVPDSGIELQCTLAPDRSLGWAWRVKHGQLENRP
NT seq 2826 nt NT seq  +upstreamnt  +downstreamnt
atggcagtgatgggaattgcatgccaaggagctcctgatccagccatcaagcacaaaaag
gagctcacagctgctgaggggctgaaggagacagtgagtgaaaagcagagcagtgtttgt
aaagtaaaagtagaagattcaaagaaggtcatctttcacagtcagtggaaaatcctgaat
gatgtaatcaccaaaggaacagcaaaagaagaaacagaaggaggctgtgcatcaatttct
attattgcccaagcagaatgtgaaaacagtcaggagttcagccccactttatcagagaga
tcctttattgcccacagtaaacgttacagcagccgctcagacagcctcgatcacatcccc
aacaatgtggcccatgccacggagggcaggatggcacccacctggagagggaggcaccgg
ggcagggccaggaagaaacggcacaagaaaagatccaagctgaaaggactacctgtggct
gctggcaggagaagtccaagaactccagaacaggagagctgcaccccaattcctgtccag
gaggatgaatcccaccaaagcactctttacagaaacagtttttgggttcctgaatttaac
aaggacttgggctatgatccactgtcttttgagaagcctgcccatgcctcttcgtccatg
tgcaaactccattcccaaaggagccaatacaaaacagaactgcacaagctgatcagccct
attcagtgccttaatcatgtttggaaacagagggacactgttccccagcctgagactctc
catccttttccctacaacatccttcccccccatttcccacatgtggacaatcctctccat
accatgaagcagaaagttctggacacatacttccatggtgacctcaactatcaagacagt
catttatctagcctaaacttagaatataatttcaccaaatgcatcaaccagtctgtgcaa
accagttcagacaagctttctgtggaagaatatttggtagatgccttgaaggggagtgtg
agttttggtgaaccacaaaatttagccagcctggccaagacatggagaggaggtgggctg
gagctgaaggaacatttccatgaagagagtgaaaatgaaggcgtgctgctcaacgagaag
ctgaagccggtggattacgagtaccgagaagaggttcactggaccaagtgccctggctcc
ttgggcattggctcttttggggaagtgtacaagatagaggacaagcagacaggatttcag
tgtgctgccaagaaggtgcaggtggaacatttccgtgccgaggagctgacgacgtgcgcg
gccgtggcgagccccagcgtggtgcccctctacggggctgtcaaggaggggccctgggtc
accatcttcatgaagctgatggagggtggctcattagggcaactcattaaacagagtggc
tgcctgccagaggatagagccctcagctacctgggccaggtgttagagggcctggagtat
cttcatgctcaaaacattctccatggagatgtcaaagcggagaacgtgctgctgtcagct
gatggcagcagggccctgctgtgtgactttggccactctgctcacctgcaccccgacggg
ctggggaagtgcttggtcacagggaactacgtgcctggcacagagacccacatggccccg
gaggtggtgatggggaagcgctgtgactccaaggtggacgtgtggagcagctgctgtatg
atgctgcacatgctcaacggctgccacccctggacccagtattacaaccaccctctctgc
ctgaagatcgctaaagagccgcctcctctgagggaaattccaccttcctgcaaccctctc
actgctgagattattaagctggggctggagaaggagcctctgcacagggcatctgcatca
gagctcaaaaccaaaaccagtgtggcactggaggaagtgggaggtgtgagaagcccctgg
aaaggtgaatacagagagcccagacatttatctttgagcaaagaaaacagtgcacagaca
tccctgtcccccacagtgagcccagtttctgagactgcttctgacccaaatctgtcagtc
aaagtttcctgtgccagcccagtcctaccacctccatctctggagcaaacagaggaggtt
gagggaagccactggaatgaaggcaaggagttacctgagacctgtgatccctcacctctc
tcctcgactcccctgcccctgaagacctgcagccacgtggaaagagccacaaccatttca
gagcaagaacttcagcagctggaaattgaactgtttctgaacagcctttcccagccttac
tctctggaagaacaagagcaaatgctttcgtgcctcagcattgacagcccctttgtgtca
gatgccagtgagaggaactccatgaaggcttctcacagcctgagggacaccatgagctct
gggatccattcctggaacagccaagcagaggggcagagctgcagctggaacaacctgctg
agccgcagccggcacacggacactcccagctacttcaacggagtgaaaatccagatccag
ttgctaagtggagaaaacttgcacatcagggatttccacagaacaaaggtgggagacatt
gccacggggataagcagccagatccccgtgcccgccttcagcctggtgaccaaggagggg
cagcccgtgcactacgacatggaggtgcccgactcgggcatcgagctgcagtgcacgctg
gcgcccgaccgcagcctgggctgggcctggcgcgtcaagcacggccagctggagaacagg
ccctga

DBGET integrated database retrieval system