KEGG   Ficedula albicollis (collared flycatcher): 101813687
Entry
101813687         CDS       T02815                                 

Gene name
PTGER2
Definition
(RefSeq) prostaglandin E2 receptor EP2 subtype
  KO
K04259  prostaglandin E receptor 2
Organism
fab  Ficedula albicollis (collared flycatcher)
Pathway
fab04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:fab00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101813687 (PTGER2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:fab04030]
    101813687 (PTGER2)
G protein-coupled receptors [BR:fab04030]
 Rhodopsin family
  Lipid
   Prostaglandin
    101813687 (PTGER2)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srx Sid-5 7TM_GPCR_Srbc
Other DBs
NCBI-GeneID: 101813687
NCBI-ProteinID: XP_005047898
LinkDB
Position
5
AA seq 379 aa
MGTGRVRGSRTGTGTIGPNRDRPCSRLSDRYRDSRSGQARSVRIPRLRSVHPCGAVPRGP
GAVPGARRGPRQRPPALFHVLVLALVVTDLLGTCSVSPLVLASYHRNLTLTALARGGHIC
LYFGFAMSFFGLATMLILFTMALERCLALGRPYFYERFLSPRTGLVALPAIYSFSAAFCS
LPLLGFGRFVQYCPGTWCFIQMHHQAGVDVAGLNVTFSLLYATLLLFLIVAVLLCNLSVI
ANLARMHRRGQRTRRVTGPEQPRASGCGRRIFSMAEEIDHLLLLSIMTITFVICSLPFTI
RAYVNKLSREEADHEWDLLALRFLSINSIVDPWVFAILRPPVLRLLRSVLCCQLAPAAPG
GRAVSPAVAKLARPHLCGR
NT seq 1140 nt   +upstreamnt  +downstreamnt
atggggaccggccgtgttcggggctcccggaccggtaccgggactatcggaccgaaccgg
gacaggccatgttcgaggctctcagaccggtaccgggactctcggtccggccaggctcgg
tccgtgcgcatcccccggctgcgctccgtccatccctgcggggcggtaccgcgggggccc
ggggcggtgccgggggcccgccgcgggccccggcagcgcccgcccgcgctgttccacgtc
ctggtgctggccctggtggtcaccgacctgctgggcacctgctccgtcagccccttggtg
ctggcatcctaccaccgcaacctcaccctgaccgcgctggcccgcggagggcacatctgc
ctctacttcggcttcgccatgagcttcttcggcctcgccaccatgctcatcctcttcacc
atggctctggagcgctgcctggccctggggcgaccctacttctacgagcgcttcctgagc
ccccgcacggggctggtggccctgccggccatctacagcttctcggccgccttctgctcg
ctgccgctgctgggcttcggccgcttcgtgcagtactgccccggcacctggtgcttcatc
cagatgcaccaccaggccggcgtggatgtggcggggctgaacgtcaccttctcgctgctc
tacgccaccctgctgctcttcctcatcgtcgccgtgctgctctgcaacctgagcgtcatc
gccaacctggcccgcatgcaccggcgggggcagaggacgcgccgggtcaccggccccgag
cagccccgcgcctcgggctgcggccgccgcatcttctccatggccgaggagatcgaccac
ctgctgctgctctccatcatgaccatcaccttcgtcatctgctccctgcccttcacgatc
cgagcctacgtgaacaagctcagccgggaggaggcggaccacgagtgggacctgctggcg
ctgcgtttcctgtccatcaactccatcgtggacccctgggtgttcgccatcctgcgcccg
cccgtgctgcgcctcctgcgctccgtgctctgctgccagctcgcccccgcggcccccggc
ggccgcgccgtgtcccctgctgtcgccaagctggcacggccgcacctctgcgggcggtag

DBGET integrated database retrieval system