KEGG   Ficedula albicollis (collared flycatcher): 101813896
Entry
101813896         CDS       T02815                                 

Gene name
PTGDR
Definition
(RefSeq) prostaglandin D2 receptor
  KO
K04332  prostaglandin D2 receptor
Organism
fab  Ficedula albicollis (collared flycatcher)
Pathway
fab04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:fab00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101813896 (PTGDR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:fab04030]
    101813896 (PTGDR)
G protein-coupled receptors [BR:fab04030]
 Rhodopsin family
  Lipid
   Prostaglandin
    101813896 (PTGDR)
SSDB
Motif
Pfam: 7tm_1 DUF1449
Other DBs
NCBI-GeneID: 101813896
NCBI-ProteinID: XP_005047899
LinkDB
Position
5
AA seq 315 aa
METEGYRCRSSRHIESGQSAVPSSVLFAAGLLGNVLALLLLGQHRRRSRSPGGRPPRVSA
FYVLVSGLAVTDLLGKCLISPMVLAAYAYNRSLSELGPGGRGEEQPGVLCQLFAFLMAFF
GLAPTLLLLAMALECWLSLGHPYFYRRHLTRRLGATLGPLVAGLCALFCALPLLGFGAPM
QYCPGTWCFIRMAGGGPRQLGFPVLYASLMGLLVLAIVACNVSSMRHLYGMARRQPRRGA
PPAAAPRMEELDHLVLLGLMTVLFTVCSLPLIIRAYMGAFAADFNENADLSALRFLSVNS
IVDPWVTDPPQLGIP
NT seq 948 nt   +upstreamnt  +downstreamnt
atggagaccgagggctaccgctgccgcagcagccgccacatcgagagcggccagtcggcc
gtgcccagctcggtgctgttcgccgcggggctcctggggaacgtgctggcgctgctgctg
ctgggccagcaccggcggcgctcccgctcgcccgggggccgcccgccgcgggtctcggcg
ttctacgtgctggtcagcgggctggctgtcaccgacctgctgggcaagtgcctgatcagc
cccatggtgctggcagcctacgcctacaaccgcagcctcagcgagctggggccgggcggc
cgcggcgaggagcagccgggggtgctgtgccagctcttcgccttcctcatggctttcttc
gggctggcccccaccctgctgctgctggccatggctctggagtgctggctttccctgggg
catccctacttctaccggcggcacctgactcgccgcctgggagccacgctggggccgctg
gtggccgggctgtgcgcgctgttctgcgccctgcccctgctgggttttggggctcccatg
cagtattgcccgggcacctggtgcttcatccgcatggccgggggtggcccgcgccagctg
ggcttccccgtgctctacgccagcctgatgggcttgttggtgctggccatcgtggcgtgc
aacgtgagcagcatgcggcacctgtacggcatggcccgccggcagccccgccgcggggcg
ccccccgccgccgccccccgcatggaggagctcgaccacctcgtcctgctggggctcatg
accgtcctgttcaccgtctgctccctgccgctcatcatccgcgcctacatgggcgccttc
gccgcggatttcaacgagaacgccgacctgagcgcgctgcgcttcctctccgtcaactcc
atcgtggacccctgggtgacagacccgccccagctcggcatcccctga

DBGET integrated database retrieval system