KEGG   Ficedula albicollis (collared flycatcher): 101814245Help
Entry
101814245         CDS       T02815                                 

Gene name
AURKA
Definition
(RefSeq) aurora kinase A
  KO
K11481  aurora kinase A [EC:2.7.11.1]
Organism
fab  Ficedula albicollis (collared flycatcher)
Pathway
fab04114  Oocyte meiosis
fab04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:fab00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    101814245 (AURKA)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    101814245 (AURKA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fab01001]
    101814245 (AURKA)
   01009 Protein phosphatases and associated proteins [BR:fab01009]
    101814245 (AURKA)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:fab03036]
    101814245 (AURKA)
Enzymes [BR:fab01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101814245 (AURKA)
Protein kinases [BR:fab01001]
 Serine/threonine kinases: AGC group
  AUR family [OT]
   101814245 (AURKA)
Protein phosphatases and associated proteins [BR:fab01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     101814245 (AURKA)
Chromosome and associated proteins [BR:fab03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    101814245 (AURKA)
   Spindle formation proteins
    101814245 (AURKA)
  Sister chromatid separation proteins
   Aurora kinases
    101814245 (AURKA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like YrbL-PhoP_reg FTA2 APH TFIIA Pkinase_fungal Seadorna_VP7 RNA_pol_Rpc4 Presenilin Ndc1_Nup
Motif
Other DBs
NCBI-GeneID: 101814245
NCBI-ProteinID: XP_005057454
UniProt: U3K8Q3
LinkDB All DBs
Position
20
AA seq 442 aa AA seqDB search
MCYVLRSPAGRAVRAAAAMDRNAKENHAAYPGRAAKVANPIGDAPRRVPVSQHSAQSRLL
ASGVPARVLCPANFAQRVPAQAQKPVLSTQKLSNNQTTQQLRPKPPQQATVRPQAASKSS
EKPAQAAAPAKDPEAESTSKQKSEETAKKKTEETKKKSEETKKRQWSLDDFEIGRPLGKG
KFGNVYLAREKQSKFILALKVLFKTQLEEAGVEHQLRREVEIQSHLRHPNILRLYGYFHD
VTRVYLILEHAPRGEVYKELQRLTKFDEQRTATYITELADALSYCHSKRVIHRDIKPENL
LLGSNGELKIADFGWSVHAPSSRRTTLCGTLDYLPPEMIEGRTHDEKVDIWSLGVLCYEF
LVGKPPFETQTYQETYRAISRVEFKFPPFVTEGARDLISKLLKHNPFHRLPLKDVLLHPW
ITANSTKTPTSRKSDGAAPSKT
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgtgctacgtgctccgctcgcccgcaggcagagccgtgcgtgccgctgccgctatggac
aggaacgccaaggagaaccacgccgcctaccccggccgcgctgctaaggttgcaaatccc
atcggggatgcccccagacgtgtccctgtgtcccagcattcagcccagagccggttactg
gccagtggagttccagcacgtgttctgtgtcctgcaaactttgcccagagggttcctgca
caagcccaaaaacctgtattgtcaacccaaaaactgtccaacaaccaaaccacgcagcag
ctccgacccaaaccgccccagcaggcaactgtgcgacctcaggctgcaagcaagagcagt
gagaaacctgcccaggctgcagcacctgcaaaagaccctgaagcagaaagcacctctaaa
cagaaaagcgaagagactgccaagaagaaaactgaagagaccaaaaagaaaagtgaagaa
actaaaaaaaggcaatggtctcttgatgattttgaaattggtcgtcctctggggaaagga
aaatttgggaatgtgtacctggcacgtgaaaaacagagcaaatttatccttgccctgaaa
gtgctctttaaaacacagcttgaggaagctggtgtagaacatcaactacgaagagaagtg
gaaatacagtctcatcttaggcaccccaacattctcagattatatggctacttccatgat
gtgacaagagtctacctgatcctggagcatgcacctcgtggagaagtctacaaggaactt
cagaggctcaccaagtttgatgagcaaagaactgctacttacatcacagaacttgcagat
gccctctcgtactgtcactccaagcgtgtgatccacagagacatcaagccagagaacttg
ctgcttggatctaatggagagttaaaaattgctgactttgggtggtctgtgcatgctcca
tcctctaggagaacaactctctgtgggacacttgattacctgcctcctgaaatgattgag
ggaagaacacatgatgaaaaggtggatatctggagcctgggagttctgtgctatgaattc
cttgtagggaaaccaccttttgaaacacaaacctatcaagaaacctacagagctatttcc
agggtggagttcaagtttcctccatttgtaacagaaggtgcaagggatttaatttccaag
ctgctgaagcacaaccccttccatcgcctgcccctgaaggatgtgctgctccacccctgg
atcacagcaaactctaccaagactcccaccagcaggaagagcgatggtgctgccccatcc
aaaacatag

DBGET integrated database retrieval system