KEGG   Ficedula albicollis (collared flycatcher): 101814650
Entry
101814650         CDS       T02815                                 

Gene name
KITLG
Definition
(RefSeq) KIT ligand
  KO
K05461  KIT ligand
Organism
fab  Ficedula albicollis (collared flycatcher)
Pathway
fab04010  MAPK signaling pathway
fab04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:fab00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101814650 (KITLG)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    101814650 (KITLG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:fab04052]
    101814650 (KITLG)
Cytokines and growth factors [BR:fab04052]
 Growth factors
  Growth factors (RTK binding)
   101814650 (KITLG)
SSDB
Motif
Pfam: SCF
Other DBs
NCBI-GeneID: 101814650
NCBI-ProteinID: XP_005039969
LinkDB
Position
1A
AA seq 406 aa
MPCQRRLDGHKNLGGDTARAGDPNWPEGYSTVYGITFTIETGTTAAWELAVADDAKAILD
GLQRTTIDVVVVMIMDIHRVPCGYTSVCKGVGEDVLGLGKSRKGKYSMVTKRSNSCESRL
PVELVNTWIITCFCLQLLLLNPLVKAKSSCGNPVTDDVNDIAKLVGNLPNDYMITLKYVP
KMDSLPNHCWLHLMVPEFSKSLHNLLQKFSDIPDMSDVLSNYSIIDNLTRIINDLLACLA
FDKNKDIVKENGHLYEEGHFIPEDFFRHFNSTIEVYKESADRLDKNDCILPSTVGTPEND
SRVAVTKTFLFPPVAASSLRNDSIGSSTSSNKEALGFISSSSLQGISIALTSLLSLLIGF
ILGAIYWKKIHPKSRPESDETTQCHDYQEENEISMLQQKEKEHLQV
NT seq 1221 nt   +upstreamnt  +downstreamnt
atgccctgccagagaaggctggatgggcacaagaatctgggaggggacacggccagggca
ggtgacccaaactggccagagggatattccacagtatatggcatcacattcaccatagaa
actgggaccactgctgcttgggaactggcagtagcagatgatgccaaagccattctggat
ggactgcagaggaccacaattgatgtggtcgtggtgatgatcatggacattcacagagtc
ccctgtgggtacacaagtgtgtgcaaaggtgtgggggaagatgttctagggttgggaaaa
tcacggaagggcaaatacagtatggtcacgaaaagatcaaacagctgtgagagcaggttg
cctgttgaacttgtgaatacttggattatcacttgcttttgtcttcaactactcctactt
aatcctcttgtcaaagccaagagttcctgcgggaatccagtcacagatgatgtgaatgac
attgcaaaattggttggaaatctcccaaatgattatatgataacccttaaatatgtcccg
aagatggatagtctgcctaatcactgttggttgcatttgatggtgcctgaattttcaaag
agtctacataatcttctccagaaattttcagatattccagatatgtcagatgttttaagc
aactattcaatcatcgataatctcacaaggataattaatgatcttttggcatgccttgct
tttgataaaaacaaggatattgtaaaagaaaatggccacctttatgaagaaggtcacttc
attcctgaggatttttttaggcactttaatagtaccattgaggtctacaaagagtctgca
gacagattggataaaaatgactgcattctgccttcaacagtaggaacaccagagaatgat
tccagagtcgctgtcacaaaaacatttttgtttcctcccgttgctgccagctctcttagg
aatgacagcattggcagtagcactagcagtaacaaagaagcacttggcttcattagcagc
tccagcctgcaagggatcagcatagcactgacatcattgctgtctctccttattggcttt
attttgggagccatatactggaagaaaatacatcccaaatccagaccagaaagtgatgaa
acgacacagtgtcatgactatcaagaggaaaatgagataagtatgttgcagcaaaaagaa
aaggaacatctacaagtgtag

DBGET integrated database retrieval system