KEGG   Ficedula albicollis (collared flycatcher): 101814878Help
Entry
101814878         CDS       T02815                                 

Gene name
HK1
Definition
(RefSeq) hexokinase-1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
fab  Ficedula albicollis (collared flycatcher)
Pathway
fab00010  Glycolysis / Gluconeogenesis
fab00051  Fructose and mannose metabolism
fab00052  Galactose metabolism
fab00500  Starch and sucrose metabolism
fab00520  Amino sugar and nucleotide sugar metabolism
fab00524  Neomycin, kanamycin and gentamicin biosynthesis
fab01100  Metabolic pathways
fab01200  Carbon metabolism
fab04910  Insulin signaling pathway
Module
fab_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
fab_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:fab00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    101814878 (HK1)
   00051 Fructose and mannose metabolism
    101814878 (HK1)
   00052 Galactose metabolism
    101814878 (HK1)
   00500 Starch and sucrose metabolism
    101814878 (HK1)
   00520 Amino sugar and nucleotide sugar metabolism
    101814878 (HK1)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    101814878 (HK1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    101814878 (HK1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fab04131]
    101814878 (HK1)
Enzymes [BR:fab01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     101814878 (HK1)
Membrane trafficking [BR:fab04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    101814878 (HK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 CSD
Motif
Other DBs
NCBI-GeneID: 101814878
NCBI-ProteinID: XP_005047995
UniProt: U3KFA9
LinkDB All DBs
Position
6
AA seq 917 aa AA seqDB search
MIAAQLLAYYFTELKEDQVKKIDKYLYAMRLSDETLLDVMARFRREMKNGLSRDFNPTAA
VKMLPTFVRSIPDGSEKGDFIALDLGGSYFRILRVKVSHEKKQTVQMESEIYNTPEDIMH
GSGTRLFDHVAECLGDFMEKQQIKDKKLPVGFTFSFPCRQSKLDEGILITWTKRFKASGV
EGADVVRLLNKAIKKRGDYDADIMAVVNDTVGTMMTCGFDDQRCEIGLIIGTGTNACYME
EMRHIDLVEGDEGRMCINTEWGAFGDDGSLEDIRTEFDREIDRGSLNPGKQLFEKMVSGL
YMGELVRLILVKMAKEGLLFEGRITPELLTKGKFETKHVSAIEKSKEGLNKAKEILTRLG
VEPSHEDCIAVQHVCTIVSFRSANLVASTLGAILNQLRDNKGVGRLRTTVGVDGSLYKMH
PQYARRLHKTTRRLVPDSEVRFLLSESGSGKGAAMVTAVAYRLAEQHRLIDETLAEFKLT
HEQLLQVKKRMRAEMEAGLKKKTHDTAKVKMLPTFVRSTPDGTENGDFLALDLGGTNFRV
LLVKIRSGKRRTVEMHNKIYAIPIEVMQGTGEELFDHIVTCISDFLDYMGIKGARLPLGF
TFSFPCKQTSLDAGILLNWTKGFKATDCEGEDVVYLLREGIKRREEFDLDVVAVVNDTVG
TMMTCAYEDPNCEIGLIVGTGSNACYMEEMRNIEMVDGEQGRMCVNTEWGAFGDNGCLDD
IRTIYDKAVDDFSLNAGKQRYEKMISGMYLGEIVRNILIDFTKRGFLFRGQISETLKTRH
IFETKFLSQIESDRLALLQVRTILQQLGLNSTCDDSIIVKTVCGAVSRRAAQLCGAGMAA
IVDKIRENRGLEHLEITVGVDGTLYKLHPHFSRIMHQTVKDLAPNCDVTFLLSEDGSGKG
AALITAVGCRLREAEQN
NT seq 2754 nt NT seq  +upstreamnt  +downstreamnt
atgatcgccgcccagctcctggcctactacttcacggagctgaaggaggaccaggtcaaa
aagattgataagtacctctacgccatgcggctctcggacgaaacgctgctggacgtcatg
gctcgcttcaggagggagatgaagaacggcctctccagggattttaaccccacggccgca
gtgaagatgcttcccaccttcgtgaggtccattcctgatggctcagagaaaggagatttc
attgcactggatcttggtggttcttacttccgaattcttcgggtgaaggtgtcgcatgaa
aaaaagcagacggtgcagatggaaagtgaaatttataacaccccagaagacatcatgcat
gggagtggcacaaggctttttgatcatgttgctgaatgcctgggagactttatggagaaa
caacaaatcaaagacaagaaactgccagttgggtttacattttccttcccctgtcgacaa
tccaagctagatgagggtattctgataacctggacaaagcgcttcaaagcgagcggcgtg
gagggagcagatgttgtgaggctgcttaacaaggccatcaagaaacgtggggactatgat
gcagatatcatggctgtggtgaacgacaccgtgggcaccatgatgacctgtggcttcgac
gaccagcgctgcgagatcggcttgatcatcggcacgggcaccaacgcctgctacatggag
gagatgaggcacatcgacctggtggagggtgatgagggcaggatgtgcatcaacacggag
tggggagccttcggagacgacggctcgctggaggacatcaggaccgagttcgatcgggag
attgaccgtgggtccctcaatcctgggaagcagctgtttgagaagatggtcagtgggctg
tacatgggggagctggtaaggctcatcctagtgaagatggccaaggaggggctgctcttt
gaggggagaatcacccctgagcttctcaccaaagggaagtttgagacaaagcatgtttct
gccattgaaaagagcaaagaaggtttgaacaaagccaaagaaatcctgacccgcctgggg
gtggagccgtcccacgaggactgcatcgccgtgcagcacgtgtgcaccatcgtgtccttc
cgctcggccaacctggtggcctccacgctgggcgccatcctcaaccagctgcgggacaac
aagggcgtgggccgcctgcgcaccaccgtgggcgtggatggctccctctacaagatgcac
ccacagtacgcgcggcgcctgcacaagaccacgcggcgcctggtgcccgactcggaggtg
cggttcctgctgtcggagagcggcagcggcaagggcgcggccatggtgacggccgtggcg
taccggctggccgagcagcaccgcctcatcgacgagaccctggccgagttcaagctcacc
cacgagcagctgctgcaggtgaagaagaggatgagggcggagatggaggcggggctgaag
aagaagactcacgacaccgccaaagtgaagatgctgcccacctttgtccgcagcacgccg
gatgggacagagaatggagattttctggcacttgaccttggagggacaaactttagagtt
ttgctggtgaaaatccgcagtggtaaaaggagaacggttgagatgcacaacaagatctat
gccattcccatagaggtgatgcagggaacaggagaagagctgtttgatcacatcgttacc
tgcatttctgacttcctggattacatggggataaaaggcgcacgtcttcctcttggcttc
accttttccttcccctgcaagcagaccagtctggatgctggtatccttctcaattggaca
aaaggcttcaaagctacagactgtgagggagaagatgtggtatatttacttagagaagga
attaaaagaagagaggaatttgatttggatgtggtggctgtggtgaatgatacagtgggc
acaatgatgacttgtgcttatgaagatccaaactgtgaaatcgggctcattgtgggaacg
ggcagcaatgcctgttacatggaggagatgagaaacatagagatggtggatggtgagcag
gggaggatgtgtgtgaacacggagtggggagcgttcggggacaacgggtgcctggatgac
atcaggacaatatatgacaaagcagtggatgacttctcactgaatgctgggaagcaaagg
tatgagaagatgatcagtgggatgtacctgggggaaatagtccgcaatattttgattgac
ttcaccaaacggggtttcctgttccgaggccagatttcagagacactgaagaccagacat
atctttgaaaccaagttcctttctcagattgagagtgacaggttagccttgctgcaggtg
cgaaccatcctccagcagctggggctcaacagcacctgcgacgacagcatcattgtcaag
acggtctgcggggcggtgtccaggcgagcagctcagctgtgtggcgctgggatggctgcc
attgtagataaaattagggagaacagaggcttggagcacctggagataacagttggtgtg
gatggcactctctacaaactccacccacacttttcgaggatcatgcaccaaacagtcaaa
gacctggcgcccaactgcgacgtgaccttcctgctgtcggaggacggcagcgggaaaggg
gcagcgctcatcacagcggtgggatgcaggcttcgtgaggctgagcagaactga

DBGET integrated database retrieval system