KEGG   Ficedula albicollis (collared flycatcher): 101814945Help
Entry
101814945         CDS       T02815                                 

Gene name
NSD2, WHSC1
Definition
(RefSeq) nuclear receptor binding SET domain protein 2
  KO
K11424  histone-lysine N-methyltransferase NSD2 [EC:2.1.1.43]
Organism
fab  Ficedula albicollis (collared flycatcher)
Pathway
fab00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:fab00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    101814945 (NSD2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:fab03036]
    101814945 (NSD2)
Enzymes [BR:fab01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     101814945 (NSD2)
Chromosome and associated proteins [BR:fab03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     101814945 (NSD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PWWP SET PHD HMG_box HMG_box_2 zf-HC5HC2H zf-HC5HC2H_2
Motif
Other DBs
NCBI-GeneID: 101814945
NCBI-ProteinID: XP_016153618
UniProt: U3K5P9
LinkDB All DBs
Position
4
AA seq 1393 aa AA seqDB search
MDFSIKRSSQLLTQKINYIKMKQVPEILGNTNGKPQNCEVNRECSVYLGKAQLSATLQEG
VMQKYNGHETLPFIPADKLKDLTSRVFNGESGAQDAKLRFEPQEIKGVGTPPNTTPIKNG
SPEIKLKITKTYMNGKPLFESSICGDNGADVSQSEENEQKPANKERRSRKRSIKYDSLLE
EGLVETALVSKTSSTTEKKAPSKRDATQSTIKEEKVHLLKYNIGDLVWSKVSGFPWWPCM
VSADPVLHAYTKLKGQKKSFRQYHVQFFGDAPERAWIFEKSLVPFKEKDQFEQLCQESAR
QALTKAEKIKMLKPVSGKLRPQWEMGVKQATEAVGMTVEERRAKYTFLYVRDRPHLNPRV
AKEVGIAAEPLEEMDESSYSNEETTPDLKSMKESGIPSKRRRRTSKLSADDDAQESSQLE
DKNTTPQKSSEQADSKRGIGSPLNRKKTPASTPRSRKGDAVSQFLVFCQKYRDEVVAEHP
DASSEEIEELLESQWNMLSEKQKARYNTKFAIVTSPKSEEDSGSSLKNIGEAKRKVFQDS
PKRRSRSRSNLHGNKRNQKKRTKEPTEDFEVQEAPRKRLRMDKQNNRKRETSNDKTAKTN
SSKVTETSSSQKNQSATKNLSDACKPLKKRNRASAAESSTLAFSKSSSPSASLTENEISD
GQGDERSESPYESADETQTEVSISSKKSERGAGAKKEYVCQLCEKTGDLLLCEGLCYRAF
HLSCLGLSGRPAGKFICSECTSGVHTCFVCKERKADVKRCVVSHCGKFYHEACVKKFHLT
VFENRGFRCPLHSCLSCHVSNPSHPRISKGRMMRCVRCPVAYHAGDVCIAAGCAVIASNS
IVCTNHFTATKGKSHHAHVNVSWCFVCSKGGSLLCCESCPAAFHPDCLNIEMPDGSWYCN
DCRAGKKLHFQDIIWVKLGNYRWWPAEVCHPKNVPPNIQKMKHEIGEFPVFFFGSKDYYW
THQARVFPYMEGDRGSRYQGIKGIGKVFKNALQEAETRFREIKLQREAKETQESERKPPP
YKHIKVNKPCGKVQIYTADISEIPKCNCKPTDENPCGFDSECLNRMLMYECHPQVCPAGE
RCQNQCFTKRQYPETKIIKTDGKGWGLVAKRDIKKGEFVNEYVGELIDEEECMARIKYAH
ENDITHFYMLTIDKDRIIDAGPKGNYSRFMNHSCQPNCETLKWTVHGDTRVGLFAVCDIP
AGTELTFNYNLDCLGNEKTVCKCGAPNCSGFLGDRPKNSSTNASEEKGKKTKKRTRKRRT
KNEGKKESEDDCFRCGDGGQLVLCDRKSCTKAYHLSCLGLVKRPFGKWECPWHHCDVCGK
PSVSFCHFCPNSFCKEHQDRTVLNSMLNGQLCCSEHVLGVDSVETQKTEKPRKKLNKFKP
RRKRNRWMRAECK
NT seq 4182 nt NT seq  +upstreamnt  +downstreamnt
atggactttagcatcaaaagaagttctcaactgttaactcaaaaaattaactacatcaaa
atgaagcaggtaccagagatccttggaaataccaacgggaaacctcagaattgtgaagtg
aatcgtgaatgttctgtctacttgggcaaagcacaactttctgccactctacaggaaggt
gtcatgcaaaaatacaatggccatgagactcttccatttattccagctgataaattgaaa
gatctgacctctcgggtgtttaatggcgagtccggggcccaggatgccaagctgcgcttt
gaacctcaggaaataaagggagttggaacaccccccaacactactcctatcaagaatggc
tctccagaaataaagctgaaaatcactaaaacctacatgaatgggaagcctcttttcgaa
tcctccatttgtggagacaatggtgcagatgtgtctcagtcggaggaaaatgaacaaaag
ccagcaaacaaggagaggagaagcagaaaaagaagcataaaatatgactccttacttgag
gagggtcttgtagaaacagctttagtatcaaagacttcaagcaccactgaaaagaaggct
ccttctaagagagatgcaactcaaagtaccatcaaagaggaaaaagtccatctgttgaag
tataatataggagatctagtgtggtcaaaagtgtctggtttcccatggtggccgtgtatg
gtttctgctgatcctgttctccatgcctacactaaactaaaaggacagaaaaagagtttt
cgtcaatatcacgttcagttttttggagatgccccagagcgagcctggatatttgagaag
agcctggtgcccttcaaagaaaaagaccagtttgaacaattatgccaagagagtgcaaga
caagccctcactaaagcagagaaaataaagatgctgaagcccgtgtcagggaagctgcgg
ccgcagtgggagatgggagtgaaacaagccactgaagccgtgggcatgacagtggaggag
cgcagggccaagtacaccttcctctatgtcagggacagacctcatctcaatcctcgagtg
gccaaggaggttggcattgctgcagagcccttggaggagatggatgagtcatcttactca
aatgaagaaaccactccagatctgaaatcgatgaaagagtctggaattcctagcaagagg
aggagaaggacatcaaaactgtctgctgatgatgatgcacaagagagcagtcagttggag
gataagaatactactcctcagaagtcatctgaacaggcagattccaaaagagggataggc
tcccctctcaatagaaagaaaactccagcatctaccccacgaagcagaaagggcgatgca
gtatctcagtttttggtcttttgtcagaagtacagagatgaggtggttgctgaacatcca
gatgcttcgagtgaggagattgaagagctgctcgagtcgcagtggaacatgcttagtgaa
aaacagaaagctcgctataacacaaagtttgccatagtgacctctcccaaatctgaagaa
gactctggttcatcattgaagaatattggagaggccaaacgtaaagtgtttcaagactca
cctaaaaggagatcaagatccagaagtaatttacatggaaataaaagaaaccaaaaaaag
aggacaaaggagcctacagaagattttgaagttcaggaagcacctaggaaaagactcagg
atggataaacagaataatcggaagagggagacaagcaatgacaaaacagcaaaaacaaac
tcttctaaagtcacagaaacctcctcttcacaaaagaaccagtcagcaacgaaaaatctg
tctgatgcatgtaaacctctgaagaagcgaaatcgggcttcagcagcagaatcttcaact
cttgcttttagcaagagttcatctccttcagcttccttaactgagaatgagatctctgat
ggccaaggagatgagcgctcagagtccccctatgagagtgctgatgagactcagactgaa
gtgtctatatcatccaaaaaatctgagcgaggagcaggagcaaaaaaagaatatgtgtgt
cagctgtgtgaaaaaacaggtgatctcctgctgtgtgaaggactttgctatcgagctttt
catctaagctgccttgggctctctggaagaccagctggaaaattcatttgtagtgaatgt
acatcaggtgtgcacacctgttttgtgtgtaaggagagaaaagcagatgtgaaacgctgt
gttgtgtctcactgtggaaaattctaccacgaagcttgtgtgaaaaaatttcatctcact
gtgtttgagaacagggggtttcgatgtcctctccacagctgcctcagttgtcatgtcagt
aacccctcacatccacgaatttcaaaagggaggatgatgcgctgcgtgcgctgcccggtc
gcgtaccacgccggggacgtctgcatcgccgcgggctgcgccgtcatcgcctccaacagc
atcgtctgcaccaaccacttcactgccaccaagggcaagagccaccacgcccacgtcaat
gtcagctggtgctttgtgtgctccaaaggtggaagtttgctgtgctgtgagtcctgccca
gcagcctttcaccctgactgcttgaacattgaaatgccagatggaagctggtactgcaat
gactgcagggcgggcaagaagctccatttccaggatattatttgggttaagctgggaaat
tacagatggtggcctgcagaagtttgccatccgaaaaacgttcccccaaatatccagaaa
atgaagcatgaaatcggagaatttcctgtgtttttctttggttctaaggattactattgg
acgcaccaagcacgggtgttcccttacatggagggagacagagggagtagataccaaggg
atcaaaggaattggaaaagtcttcaaaaatgccttgcaagaagctgaaactcgatttaga
gaaataaaactacagcgagaagccaaagaaacccaggagagtgaacgtaaacctccacca
tacaaacacattaaggtgaataaaccttgtggtaaagtgcagatctacactgctgacata
tctgagattcccaagtgcaactgcaagcccacggatgagaacccctgtggctttgactcc
gagtgcctgaatcggatgctgatgtacgagtgccacccccaggtgtgcccggcaggagag
cgctgccagaaccagtgcttcaccaagcgccagtaccccgagacaaagatcatcaaaacc
gacggcaaaggctggggcctggtggccaagagggacattaaaaagggggagtttgtgaat
gagtacgtgggagagctgatcgatgaagaggagtgtatggcaaggatcaaatatgcacat
gaaaatgacatcacccacttctatatgcttactattgataaggaccgtattattgatgct
ggccccaaaggaaactattctcggtttatgaatcacagctgccaaccaaattgtgaaact
ctgaagtggacagtgcatggagacactcgtgtggggctctttgctgtgtgtgacattcct
gcagggacagagctgacttttaattacaaccttgactgtctgggcaatgaaaaaacagtc
tgcaaatgtggtgccccaaactgcagtggatttcttggggacagaccaaagaattcttcc
actaatgcctcagaagaaaaaggcaaaaagaccaaaaagagaacacggaaacgcagaacg
aaaaatgaagggaagaaagaatctgaagatgattgtttccggtgtggtgatggaggccag
ctggtgttgtgtgacaggaaatcttgtactaaagcttatcatctctcctgccttggcttg
gtgaaacggccttttgggaagtgggagtgtccttggcaccactgtgatgtttgtggcaaa
ccttctgtttctttctgccacttctgcccaaactctttctgcaaggagcaccaggacagg
acagtactaaattccatgttgaatggacagttatgctgctctgaacatgttctcggggtg
gattctgttgaaactcagaagactgagaaaccccgcaaaaaactgaacaagttcaagccc
aggagaaagaggaacagatggatgagagctgaatgcaaatag

DBGET integrated database retrieval system