KEGG   Ficedula albicollis (collared flycatcher): 101814974Help
Entry
101814974         CDS       T02815                                 

Gene name
TMPRSS2
Definition
(RefSeq) transmembrane protease, serine 2
  KO
K09633  transmembrane protease serine 2 [EC:3.4.21.-]
Organism
fab  Ficedula albicollis (collared flycatcher)
Pathway
fab05164  Influenza A
Brite
KEGG Orthology (KO) [BR:fab00001]
 09160 Human Diseases
  09172 Infectious diseases: Viral
   05164 Influenza A
    101814974 (TMPRSS2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:fab01002]
    101814974 (TMPRSS2)
Enzymes [BR:fab01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     101814974 (TMPRSS2)
Peptidases [BR:fab01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   101814974 (TMPRSS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin SRCR_2 Hepsin-SRCR DUF1986 SRCR Ldl_recept_a Trypsin_2 DUF3149 DUF3139
Motif
Other DBs
NCBI-GeneID: 101814974
NCBI-ProteinID: XP_005037242
LinkDB All DBs
Position
1
AA seq 485 aa AA seqDB search
MTSTLGPPPPYYENRGFQPEPLYAARQAAGAAPYPQLFSTNPPSVPSYMPRVATHQPSPP
AARPPRRTCAASLRKTIIIILSILIVICCAIAAFFIWYFVENTCLSSLVGCGSSGVCMSP
SQWCDGVSDCPNGEDETRCVRLFGPNFILEVYSPVSNSWYPVCHDDWNDDYGKIACRDMG
YNVDTYFYSHGVPPEASFKSYMKLNTSAGNIDLYKKLYNSGSCATGNVVSLRCIECGLSS
KGVSTMNRIVGGSGAVLGQWPWQVSLHVQGTHVCGGSIITHSWIVTAAHCVEGRLSDPHS
WRVYAGILNQDEMLFRSGYKVQLIISHPDYDTDSKDNDVALMKLETPLSFTETVKPVCLP
NPGMMFQPNQQCWISGWGAEYQGGKTSNNLNYVAVPLIERSRCNAVFIYNGMILPTMICA
GDLAGGVDSCQGDSGGPLVTLHHSVWWLVGDTSWGTGCATPNKPGVYGNMTVFTDWIYRN
MQANR
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgacctctactctaggtccaccaccgccatactacgagaacaggggcttccagccagag
cccctctacgctgccaggcaggcagcaggtgctgctccttacccccagctcttctccaca
aaccctccctccgtgccaagctacatgcccagggttgccacccaccagcccagcccgccc
gcagcgcgcccgcccaggagaacgtgcgccgccagtctaaggaaaaccataataataata
ttatctatattaatagtcatttgttgtgcaattgctgctttcttcatctggtattttgta
gagaatacctgtctcagctccctggtggggtgtggatcctcgggggtgtgcatgtccccc
tcccagtggtgtgacggagtgagcgactgccccaacggggaggacgagacccgctgtgtt
agactttttggaccaaattttatcctggaagtttattcacctgtcagcaactcctggtat
cctgtttgccatgatgactggaatgatgattatgggaagattgcatgcagagacatgggc
tacaacgtagatacgtatttctacagtcatggggtaccccctgaagccagctttaagagc
tacatgaagctgaacacaagtgctgggaatatagacttgtacaaaaagctgtacaacagt
ggttcctgtgccacaggaaacgtggtttctctgcgctgcatagagtgtggcctgtccagc
aagggcgtgagcacgatgaacaggatcgtgggtggcagcggggccgtgctggggcagtgg
ccctggcaggtcagcctgcacgtgcagggcacccacgtctgcgggggctccatcatcacc
cacagctggattgtgacagcagcacactgcgtggaagggcgactttctgacccacacagc
tggagggtttatgctgggattctgaaccaggatgagatgctctttagaagtggatacaaa
gtgcagctgataatttcccatccagattatgacacagactctaaagacaatgatgttgcc
cttatgaagctggagacaccactgagttttactgaaactgtgaagccagtttgtctgccc
aatccaggaatgatgttccagcctaaccagcagtgctggatatcagggtggggagcagag
taccaaggaggtaaaacatcaaataacttgaattacgttgcggtgcccttgatagagcgt
tcgaggtgtaatgcagtttttatctacaatggcatgattctgcccacaatgatctgtgct
ggagacctagcagggggagttgattcctgtcagggggacagtggaggtcctctggtgact
ctccaccactctgtgtggtggctggtcggagataccagctggggcactggctgtgccact
cccaacaaacctggagtgtatggcaatatgactgtgtttacagactggatttatagaaat
atgcaggcgaacagatga

DBGET integrated database retrieval system