KEGG   Ficedula albicollis (collared flycatcher): 101815051
Entry
101815051         CDS       T02815                                 

Gene name
CACNA1C
Definition
(RefSeq) calcium voltage-gated channel subunit alpha1 C
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
fab  Ficedula albicollis (collared flycatcher)
Pathway
fab04010  MAPK signaling pathway
fab04020  Calcium signaling pathway
fab04260  Cardiac muscle contraction
fab04261  Adrenergic signaling in cardiomyocytes
fab04270  Vascular smooth muscle contraction
fab04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:fab00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101815051 (CACNA1C)
   04020 Calcium signaling pathway
    101815051 (CACNA1C)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    101815051 (CACNA1C)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    101815051 (CACNA1C)
   04261 Adrenergic signaling in cardiomyocytes
    101815051 (CACNA1C)
   04270 Vascular smooth muscle contraction
    101815051 (CACNA1C)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:fab04040]
    101815051 (CACNA1C)
Ion channels [BR:fab04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   101815051 (CACNA1C)
SSDB
Motif
Pfam: Ion_trans GPHH Ca_chan_IQ CAC1F_C PKD_channel DUF4834
Other DBs
NCBI-GeneID: 101815051
NCBI-ProteinID: XP_016161654
LinkDB
Position
1A
AA seq 2218 aa
MFQALVRQAYHPLPSHQPGEPDAKYKGKLVHETQLNCFYIKPGGSNYGSPRPAHANMNAN
AAAGLAPEHIPTPGAALSWQAAIDAARQAKLMGSAGNATISTASSTQRKRQQYGKQKKQG
STTATRPPRALLCLTLKNPIRRACISIVEWKPFEIIILLTIFANCVALAIYIPFPEDDSN
ATNSNLERVEYLFLIIFTVEAFLKVIAYGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILE
QATKADGGNSIGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIAL
LVLFVIIIYAIIGLELFMGKMHKTCYHVQGGLIDTPAEDDPSPCAPQSAHGRQCQNGTEC
KAGWEGPKHGITNFDNFAFAMLTVFQCITMEGWTDVLYWVNDAIGRDWPWIYFVTLIIIG
SFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPENE
DEGMDEEKPRNMSMPTSETESVNTDNVPGADMEGENCGARLAHRISKSKFSRYWRRWNRF
CRRKCRAAVKSNVFYWLVIFLVFLNTLTIASEHYNQPDWLTEVQDTANKVLLALFTAEML
LKMYSLGLQAYFVSLFNRFDCFIVCGGILETILVETKIMSPLGISVLRCVRLLRIFKITR
YWNSLSNLVASLLNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDEMQTRRSTFDNF
PQSLLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYILLNVFLAIA
VDNLADAESLTSAQKEEEEEKERKKLARTASPEKKQEMEKTAVEEETKEEKIELKSITAD
GESPPATKINVDDYQPNENEEKSPYPTTEAPAEEDEEEPEMPVGPRPRPMSELHLKEKAV
PMPDASAFFIFSPNNRFRVHCHRIVNDNIFTNLILFFILLSSISLAAEDPVRHLSFRNQI
LFYFDIVFTVIFTIEIALKILGNADYVFTSIFTLEIILKMTAYGAFLHKGSFCRNYFNIL
DLLVVSVSLISFGIQSSAINVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNI
VIVTTLLQFMFACIGVQLFKGKLYSCTDSSKQTEAECRGYYITYKDGEVSQPMIQPRSWE
NSKFDFDNVLTAMMALFTVSTFEGWPELLYRSIDSHMEDVGPIYNHRVEISIFFIIYIII
IAFFMMNIFVGFVIVTFQEQGEQEYKNCELDKNQRQCVEYALKARPLRRYIPKNQYQYKV
WYVVNSTYFEYLMFVLILLNTICLAMQHYGQSCMFKEAMNILNMLFTGLFTVEMVLKLIA
FKPKGYFSDPWNVFDFLIVIGSIIDVILSETNHYFCDAWNTFDALIVVGSIVDIAITEVN
PAEHTQCSSSMNAEENSRISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVA
LLIVMLFFIYAVIGMQVFGKIALNDTTEINRNNNFQTFPQAVLLLFRCATGEAWQEIMLA
CLPDKKCDPESEPANSTEADHSCGSSFAVFYFISFYMLCAFLIINLFVAVIMDNFDYLTR
DWSILGPHHLDEFKRIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLV
SMNMPLNSDGTVMFNATLFALVRTALRIKTEGNLEQANEELRAIIKKIWKRTSMKLLDQV
VPPAGDDEVTVGKFYATFLIQEYFRKFKKRKEQGLVGKPSQRNALSLQAGLRTLHDIGPE
IRRAISGDLTAEEELDKAMKEAVSAASEDDIFRRAGGLFGNHVSYYQSDGRSGFPQTFTT
QRPLHINKSGNNHGDTESPSHEKLVDSTFTPSSYSSSGSNANINNANNTALCRFPSPPSY
PSTVSTVEGHGTPLSPTICVQEAPWKLPAKRTHYYETLARSSSRDSQLAIVCQEEVSQDE
TYDENLNEDIEYCSEPSLLSTEMLAYQDDENRQLTLPESSKGEDTRHSPKKGFLCSSALG
RRASFHLECLKRQKNQGVDVSQKTVLPLHLVHHQALAVAGLSPLLQRSHSPTSFSRLCAT
PPATPCNRGWAQQTIPTLRLDGAESSEKLNSSLPSVHCGSRCPESGGSPRRARPVSLTVP
SPSAGSSRQLHGSASSLVEAVLISEGLMQFAQDPKFIEVTTQELADACDMTIEEMENAAD
NILNGNSKQSPNGNLLPFANCRDPGQDSAGEEEEEVQNPDCRISQEELKDSRIYISSL
NT seq 6657 nt   +upstreamnt  +downstreamnt
atgtttcaagccttggttcggcaagcttatcaccccctgcccagccaccagccgggggaa
cccgacgccaagtacaaggggaagctggtgcacgaaactcagctgaactgcttctacatc
aaacctggaggttccaactatgggagtccccgtccagctcatgccaacatgaacgccaat
gcagctgcagggcttgccccggagcacatccccacgccgggggcagctctgtcctggcag
gctgccatcgatgctgccaggcaagccaagctgatgggcagcgccggcaacgccaccatc
tccacggccagctccactcagaggaaaaggcagcagtacggcaagcagaagaagcaggga
agcaccacggccacgcgtcccccccgggcgctgctgtgcctcacgctgaagaatcccatc
cgcagggcgtgcatcagcatcgtcgaatggaaaccatttgaaataattattttactgact
atttttgccaattgtgtggccttagctatctatatcccctttccagaagatgattccaat
gccaccaattccaatctggaacgagtggaatatctctttctcataatttttacagtggaa
gcatttttaaaagtaatagcatacggacttctctttcaccccaacgcttacctccgcaat
ggctggaatttactagattttataattgtggtagtagggctttttagtgcaattttagaa
caagcaaccaaagcagatggggggaattcaataggaggaaaaggtgccggattcgacgtt
aaagcactgcgagctttccgagtattgcgcccactacggctggtgtctggagttcctagt
ctccaggtggttttaaattcaattatcaaggccatggtccctttgttgcatattgccctg
ctggtgctgtttgtcattattatctatgccatcattggactggagttattcatggggaag
atgcataagacctgctaccatgtgcaagggggactgatagatacacctgcagaagatgat
ccctcgccgtgtgccccccagtctgcccacgggcggcagtgtcagaacggcaccgagtgc
aaggcgggctgggagggacccaagcacggcatcaccaactttgacaactttgcttttgcc
atgctcaccgtgttccagtgcatcaccatggagggctggacagatgtgctctactgggtc
aatgatgccataggaagggactggccctggatctattttgttacactaatcatcataggg
tcattttttgtacttaacttggttctcggtgtacttagcggggagttttccaaagaaaga
gaaaaggcaaaggctcgaggcgatttccagaagctgcgggaaaagcagcagctggaggag
gatctgaagggatacttagactggataactcaagcagaagatattgatccagaaaatgaa
gatgaaggcatggatgaggagaagcctcgaaacatgagcatgcccacgagcgagaccgag
tccgtcaacaccgacaacgtgcccggagccgacatggagggcgagaactgcggcgccagg
ctggcgcatcggatctcaaaatcaaaatttagtcgctactggcgccgatggaatcgattc
tgcaggaggaagtgccgtgctgctgtcaagtccaatgttttctactggctggtgatcttc
ctcgtgttcctcaacaccctcaccattgcctctgagcactacaaccagccagactggctc
acagaggtccaagacactgccaataaggtgctgctagctcttttcacggcagagatgctg
ctgaagatgtacagcctcggcctccaggcctactttgtgtccctcttcaaccgctttgac
tgcttcattgtgtgtggaggcatcctggaaaccatcctggtggagaccaagatcatgtca
ccgctgggcatttcggttttgagatgtgtcaggctcctgagaatattcaaaatcaccaga
tactggaactccctgagcaatctcgtggcttcactcctgaattcagtccgctccattgcc
tccctgctactgctcctcttcctcttcatcatcatcttctcactgctgggcatgcagctc
tttgggggcaagtttaactttgacgagatgcagacgaggaggagcacatttgacaacttc
cctcagtccctcctgactgtgtttcagatcctgactggggaggactggaattcggtgatg
tatgatgggatcatggcttatggcggcccctcttttccaggaatgttggtctgtatttac
ttcatcatcctcttcatctgtggaaactatatcctgctgaatgtatttttggccattgct
gtggacaaccttgctgatgctgagagtttaacatctgctcagaaagaggaggaagaggaa
aaagaaaggaaaaagctagctaggactgctagtcccgaaaagaagcaggagatggaaaaa
acagctgtggaggaagagacaaaggaggagaaaattgagctgaagtcaatcactgctgat
ggggagtccccacctgctaccaagatcaacgtggatgattatcagcccaacgaaaacgaa
gaaaagagcccttatcccacaacagaagcaccagcagaggaggatgaggaagagcccgag
atgcctgttggcccccgacctcgcccgatgtccgagctgcacctcaaggaaaaggctgtg
cccatgcctgatgccagtgcttttttcatcttcagtcctaacaacaggtttcgtgtccac
tgccatcgaatcgttaatgataacattttcaccaacctgatcctctttttcatcttgctc
agcagcatctccctggcagctgaggaccctgtgcgacacctctcctttaggaaccaaatt
ctcttttattttgatatagtttttactgtcattttcaccattgaaattgctctgaagatc
ctaggcaatgcagactatgtcttcactagtatctttacattagaaattattcttaagatg
actgcctacggggctttcctccacaagggctccttctgcaggaactatttcaacatcctg
gacctgctggtggtcagcgtttctctcatctcctttggcatccagtccagtgccattaat
gtggtgaagatcctgcgtgttctgcgggtccttaggccactgagggccatcaacagagcc
aaaggactaaagcacgtggtgcagtgcgtgtttgtcgccatccgaaccatcgggaacatt
gtgattgtcaccactttgctgcagttcatgtttgcctgcattggagttcagctgttcaag
ggcaagctgtacagctgcactgacagctccaagcagacagaagcagaatgcagagggtac
tacatcacctacaaggacggggaggtcagccagcccatgatacagccccgcagctgggag
aacagcaagtttgactttgacaacgtcctgactgccatgatggccctgttcaccgtctcc
accttcgagggctggccagagttgctgtataggtccattgattcccacatggaggatgtg
ggacccatctataatcacagggttgagatctccatcttctttattatctacatcatcatc
attgctttcttcatgatgaacatcttcgttggtttcgtcatcgtcacatttcaggaacaa
ggagaacaagagtacaagaactgtgagctggacaaaaaccagcgccagtgtgtagagtat
gccctgaaagcccggcccctgcggagatacatccccaaaaaccagtaccagtacaaggtt
tggtatgtggtcaactccacctattttgaatacctgatgttcgttctgatcctgctgaac
accatctgcctggccatgcaacactatggtcagagctgcatgttcaaggaagccatgaat
atcctcaacatgctcttcactgggctcttcaccgtggagatggtcctgaaattaattgcc
ttcaaacccaagggttactttagtgatccttggaatgtttttgacttcctcatcgtaatt
ggcagcattatagacgtcattctcagtgaaactaatcactatttctgtgatgcatggaat
acatttgacgccttgattgttgtgggtagcattgttgatatagcaatcaccgaggtgaac
ccagctgaacatacccaatgctcttcctctatgaacgcagaggaaaactctcgcatctcc
atcaccttcttccggctcttccgcgtgatgcgcctggtgaagctgctgagccgaggggag
ggcatccgcacgctgctctggaccttcatcaagtccttccaggctctcccctacgtggct
cttttaatagtgatgctgttcttcatctacgctgtgattgggatgcaggtgtttggtaaa
atcgcgctgaacgacaccacagaaatcaaccgcaacaataacttccagaccttcccccag
gcagtgctgctgctgttcaggtgtgccacaggtgaggcctggcaggaaatcatgctggca
tgtctcccggacaagaagtgtgaccccgagtcggagccggccaactccacggaggccgat
cactcctgcggcagcagcttcgccgtcttctacttcatcagcttctacatgctctgtgcc
ttcctgatcatcaatctttttgtagctgttataatggataacttcgattacctgacacgg
gactggtccattttaggaccacaccacctggatgagtttaaaaggatctgggcagagtat
gaccctgaagctaagggccggatcaagcacctggacgtggtgacgctgctgcggcgcatc
cagcccccgctgggcttcgggaagctctgtcctcacagggtggcttgcaaacgccttgtc
tccatgaatatgccactgaacagcgatgggactgtcatgttcaatgccactctctttgca
ctggtcaggacagccctgaggatcaagacagaaggtaacctggagcaagccaacgaagag
ctgagagcaataattaagaaaatctggaagcgcaccagcatgaagctgctggaccaggtg
gtgcctcctgcaggtgatgacgaggtgacggtggggaagttctacgccactttcctgatc
caggaatatttcaggaagttcaagaagcgcaaagagcaggggctggtggggaagccctcc
cagaggaacgccctgtccttacaggctgggctgcgcacgctccacgacatcgggcctgag
atccgacgggccatttctggagacctgacagctgaggaggagctggacaaggccatgaaa
gaagcagtttctgctgcctctgaagatgatatcttccggagagctggaggcttgtttgga
aaccatgtgagctattaccaaagcgatggcaggagtgggttcccccagacattcaccacc
cagagacctttgcacatcaataagtctggcaacaaccacggagacaccgagtctccatcc
cacgagaagctggtggactccaccttcactcccagcagctactcatcctcaggctccaat
gccaacatcaacaacgccaacaacactgccctgtgccgcttccccagcccacccagctac
cccagcactgtcagcacggtggaaggacatggcacccccctgtcacccaccatatgtgtg
caggaggctccctggaaactcccagccaaaaggacacattactacgagacactggcacgc
tccagttccagagacagccagctggcaattgtttgccaagaggaagtgtctcaggatgag
acttatgatgaaaatttgaatgaagacattgagtactgtagtgaaccaagtctgctctct
actgaaatgctggcataccaagatgatgaaaacagacaactcactctgccagaaagcagc
aaaggagaggacacccggcactctccgaagaaggggttcctgtgctcctcagctctaggt
cgaagagcatcttttcacctagagtgtttgaaaagacagaaaaaccagggtgtggatgtc
tcacaaaagacagtcctgcctttgcatctggtccatcatcaggcactagcagtggccggc
ctgagtcccctgctccagcgaagccattcccccacctcgttttctcggctgtgcgctacg
cccccggccacgccgtgcaaccggggctgggcacaacagaccatccccacgctgcgcctg
gacggggcggaatcctcggagaagctcaacagcagcctgccgtcggtgcactgcggctcc
cggtgcccggagagcggcggcagcccccggagagcccggcccgtgtcgctgaccgtgccc
agccccagcgccgggagcagccggcagctccacggcagcgccagcagcctggtggaagcg
gtcttgatttcggaaggactgatgcagtttgctcaagatccaaagttcattgaggtcaca
acccaggagctcgcagacgcctgcgacatgacgatagaagagatggaaaatgcagcagac
aacattctcaatggtaacagcaagcagagccccaatggcaacctcttgccttttgctaac
tgcagggacccagggcaggacagtgcaggagaggaagaggaagaggtgcaaaacccggat
tgtaggataagtcaggaggagctcaaggacagcaggatttatatcagcagcctgtag

DBGET integrated database retrieval system