KEGG   Ficedula albicollis (collared flycatcher): 101815528
Entry
101815528         CDS       T02815                                 

Gene name
NFKB1
Definition
(RefSeq) nuclear factor kappa B subunit 1
  KO
K02580  nuclear factor NF-kappa-B p105 subunit
Organism
fab  Ficedula albicollis (collared flycatcher)
Pathway
fab04010  MAPK signaling pathway
fab04210  Apoptosis
fab04218  Cellular senescence
fab04620  Toll-like receptor signaling pathway
fab04621  NOD-like receptor signaling pathway
fab04622  RIG-I-like receptor signaling pathway
fab04623  Cytosolic DNA-sensing pathway
fab04625  C-type lectin receptor signaling pathway
fab04920  Adipocytokine signaling pathway
fab05132  Salmonella infection
fab05164  Influenza A
fab05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:fab00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101815528 (NFKB1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    101815528 (NFKB1)
   04218 Cellular senescence
    101815528 (NFKB1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101815528 (NFKB1)
   04621 NOD-like receptor signaling pathway
    101815528 (NFKB1)
   04622 RIG-I-like receptor signaling pathway
    101815528 (NFKB1)
   04623 Cytosolic DNA-sensing pathway
    101815528 (NFKB1)
   04625 C-type lectin receptor signaling pathway
    101815528 (NFKB1)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    101815528 (NFKB1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101815528 (NFKB1)
  09172 Infectious disease: viral
   05164 Influenza A
    101815528 (NFKB1)
   05168 Herpes simplex virus 1 infection
    101815528 (NFKB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:fab03000]
    101815528 (NFKB1)
Transcription factors [BR:fab03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    101815528 (NFKB1)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer Ank_2 Ank_4 Ank Ank_5 Ank_3 Death
Other DBs
NCBI-GeneID: 101815528
NCBI-ProteinID: XP_005044950
UniProt: U3K0E6
LinkDB
Position
4
AA seq 982 aa
MAAEDSYIMGVSDPQMFAVDQFMGMNALFNSTNYITSEIPLRTADGPYLQIIEQPKQRGF
RFRYVCEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKYVHLHAHSLVG
KFCEDGVCTVTAGPKDMVVGFANLGILHVTKKKVFETLETRMIDACKKGYNPGLLVHPEL
SYLQAEGCGDRQLTEREREIIRQAAIQQTKEMDLSVVRLMFTAFLPDSNGSFTRKLDPVI
SDAIYDSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEDENGGMWE
GFGDFSPTDVHRQFAIVFKTPKYRDVNITKPASVFVQLRRKSDLETSEPKPFLYYPEIKD
KEEVQRKRQKLMPNFSDGYGGGSGTGGGGMYGGAGGSAGSGFSFPSYGYSAFGGMQFHPG
TTKSNAGMKHEGLSNCMAEQDRKSCDKQSDEWDMKCDVKVETVERTECRTSAVNEKKEDS
GFSCKTEVSEADCRWQDALFLEKAMQLARRHCNALFDYAVTGDVKMLLAAQRHLTAVQDD
NGDNVLHLAIIHLHTELVKNLLEVMPDLNYNDIINMRNDLYQTPLHLAVITKQAKVVEEL
LKAGADVSLLDRHGNSVLHLAATEGDDKILSLLLRHEKVSPMVNFPNGEGLSAIHMVVMA
NSMSCLKHLIAAGVNINAQEQKSGRTALHLAVEQENIPLAGCLLLEGDADVDSTTYDGTT
PLHIAAGRGSTKLAAVLKAAGANPHIENFEPLFDLDDVKDGEDDDEGIVPGTTPLDMAAN
SEVYDILNGKPYESAEVLEDLLTQGHLRELNENSKMQLYKLLELPDPTKNWSTLAQKLGL
GILNNAFRLSPSPSKTLLDNYEVSGGTVQELITALRQMDHREAIEIIQEALSISHRSSPL
EESTAKALPSSSPLTFARDTGELDNSRFQDTESTCDSGVETSFRKLSFTYSDSLNSKSSL
TLSKMALGYGHESSGQSNYIAD
NT seq 2949 nt   +upstreamnt  +downstreamnt
atggcagcagaagattcctatatcatgggagtatctgatccccagatgtttgcagtggat
cagttcatgggaatgaatgctttatttaacagtacaaattacatcacttcagaaatacca
ctacgaacagcagatggaccatatcttcagatcatagaacagccaaaacagaggggattt
cgtttccgatacgtatgtgaagggccttcgcacggtgggctgcctggtgcttctagtgaa
aagaacaagaaatcataccctcaggtcaaaatctgcaattatgttggacctgcaaaagta
attgtccagttagttactaatgggaaatacgtccacttacacgctcacagcttggtgggt
aaattctgcgaggacggagtgtgcacggttaccgcaggacccaaggacatggttgtaggg
tttgcaaatcttggaatacttcatgtcacgaagaagaaagtgtttgaaactctggaaaca
cggatgatagatgcttgcaagaagggatacaacccaggactcctggtgcatccggaactc
agctatctgcaggcagaaggatgcggagacaggcagctaactgaacgggagagggaaatc
atccgccaggcagccatccagcagaccaaggagatggatctcagcgtggtgcggctcatg
ttcacagcctttctccccgacagcaacggcagcttcacacgcaaactggatcccgttata
tccgatgcgatatatgacagcaaagctcccaatgcctccaacctaaaaattgtaagaatg
gacagaacagcagggtgtgtgacaggaggggaagagatttacctgctctgtgacaaggtt
cagaaagatgatattcaaatacgtttctatgaagaggacgagaatggtggtatgtgggaa
ggctttggagatttttctcctacagatgtacatagacagtttgctattgtgttcaaaaca
cccaagtaccgagatgtcaatatcacaaagccagcatctgtatttgtacaactgcgtagg
aaatctgatctagaaacaagcgaaccaaagccttttctctactatccggaaatcaaagat
aaagaagaagtgcagaggaaacgacagaagctcatgccgaacttctccgatggctatggg
ggaggcagtggcaccggaggtggtggcatgtatggaggggcaggtggcagtgctggctct
ggattcagttttccttcatatggatactctgcttttggagggatgcaattccatcctggc
acaacaaagtccaatgctggcatgaaacatgaaggtctatcaaattgcatggctgaacaa
gacagaaagagctgtgataaacaaagtgacgaatgggacatgaaatgtgatgtgaaggtg
gaaactgtggagaggactgaatgcagaacatctgctgttaatgagaaaaaggaggattct
ggtttttcctgcaagactgaagtaagcgaagcagattgcaggtggcaggatgctctgttc
ctggagaaggccatgcagcttgccaggcgccactgcaacgctctctttgattacgccgta
accggagatgtgaagatgctgctggcagctcagcgccatctcactgctgtccaggatgat
aatggggacaatgtccttcatttagcaattatccaccttcatactgagctggtgaaaaac
ctcttggaagtgatgcccgatttgaattacaatgacatcattaacatgagaaatgacctc
tatcagacccccctgcacctggcagtaatcacaaagcaggcaaaggtggtggaagagctg
ctgaaggctggagcagatgtcagcctcctggatcgccacggcaattctgtcttacattta
gctgctactgaaggagatgacaagattttgagtctactcctcaggcatgagaaggtatct
ccaatggtcaacttccccaatggtgaaggtctcagtgcaattcacatggtggtaatggca
aatagcatgtcctgcctcaaacatctgattgctgctggagttaacatcaatgctcaggaa
caaaaatctggacgaactgcattgcatttggctgttgaacaagagaacatccccttggca
ggctgccttttgcttgagggtgatgcagatgtggacagcactacatatgatgggacaact
ccacttcacatagcagctggaaggggctcaacaaaattggcagcagttctcaaagcagca
ggtgcaaatcctcacattgagaactttgagccattgtttgatctagatgatgtgaaagat
ggtgaagatgatgatgaagggattgtgcctggaacaacaccactggatatggcggccaac
agtgaggtctatgacatattaaatggcaaaccctatgagtcagcagaggttttggaggac
ttactcacacaaggacatttgagagagttgaatgagaattccaagatgcagctttacaaa
ctattggaattgcctgatccaaccaaaaactggtccaccctagcacaaaaactgggtctt
ggcatccttaataatgccttcaggttgagcccttccccatcgaagactctgctggataac
tatgaggtttctggtggtacagttcaagagctgatcacagctttgagacagatggatcac
agagaagccatagaaataattcaggaagcactatccatctcacacagatcatctcccttg
gaggagagtacagcaaaagctcttccatcatcgtcaccactcacctttgcaagagataca
ggtgagctcgataatagcagattccaagacacggaaagtacctgtgacagcggtgtggag
acctccttccgcaagctgagtttcacttactcagactctctgaacagcaagtcctcacta
acactcagcaaaatggccctgggctatggacatgaaagttcagggcaaagcaattacata
gctgactag

DBGET integrated database retrieval system