KEGG   Ficedula albicollis (collared flycatcher): 101816125Help
Entry
101816125         CDS       T02815                                 

Gene name
PTGS2
Definition
(RefSeq) prostaglandin-endoperoxide synthase 2
  KO
K11987  prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
fab  Ficedula albicollis (collared flycatcher)
Pathway
fab00590  Arachidonic acid metabolism
fab01100  Metabolic pathways
fab04370  VEGF signaling pathway
fab04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:fab00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    101816125 (PTGS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    101816125 (PTGS2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    101816125 (PTGS2)
Enzymes [BR:fab01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     101816125 (PTGS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF EGF_2
Motif
Other DBs
NCBI-GeneID: 101816125
NCBI-ProteinID: XP_005049987
LinkDB All DBs
Position
8
AA seq 604 aa AA seqDB search
MPLLPLALLAALLAAGRAANPCCSNPCQNRGVCMTAGPDRYECDCTRTGYYGQNCTTPEF
FTWLRVALKPSPNTVHYILTHFQGVWNIINNIPFLRDAIMRYVLTSRSHLIDSPPTYNSD
YNYKSWEAYSNLSYYTRSLPPVGLDCPTPMGVKGKKELPDSKLIVEKFLLRRKFIPDPQG
TNVMFTFFAQHFTHQFFKTDHKRGPAFTRALGHGVDLNHIYGETLERQLKLRLRKDGKLK
YQMIDGEMYPPTVRDTQAEMLYPPHVPEHLQFSVGQEVFGLVPGLMMYATIWLREHNRVC
DVLKRQHPEWDDEQLFQTTRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNQRFQY
QNRIAAEFNTLYHWHPLLPDTFHIHDQEYTFQQFLYNNSIMLEHGLSHMVKSFSKQSAGR
VAGGKNVPAAVQKVAKASIDQSRQMRYQSLNEYRKRFMLKPFRSFEELTGEKEMAAELEE
LYGDIDAMELYPGLLVEKPRPGAIFGETMVEIGAPFSLKGLMGNAICSPEYWKPSTFGGK
VGFDIVNTASLQKLICNNVKGCPFTAFHILPPEPTEATINVSTSKTAMEDINPTLLLKER
SAEL
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgccgctgctgccgctggccctgctggccgcgctgctggccgccggccgcgccgccaac
ccttgctgctcgaacccctgccagaacagaggcgtctgcatgaccgccgggccggatcgc
tacgagtgtgactgcaccaggacaggctactacgggcagaactgcaccacaccggaattc
ttcacgtggctgagggtagcgctgaaaccatcgccgaacactgtccactacatcctcacc
cacttccaaggagtctggaatatcatcaacaacattcccttcttacgggacgctatcatg
agatacgtactaacgtcaagatcacacttgattgacagcccaccaacttacaatagtgac
tacaattacaaaagctgggaagcttattccaatctttcctactacacgagaagccttcca
ccagtaggacttgactgcccaacaccaatgggtgttaaaggtaagaaagagcttccagat
tcgaagctgatcgtggagaagtttttgctgaggagaaagttcattcccgacccgcaaggc
acgaacgtgatgttcacattctttgcccagcacttcacccaccagttcttcaagacggac
cacaagcggggccctgccttcaccagagcgcttggccacggggttgacttgaaccacatt
tatggagagactctggagagacaacttaaactgaggcttcgaaaggatggaaagctaaaa
taccagatgatcgacggcgagatgtacccgccgacggtgcgggacacgcaggcggagatg
ctgtacccgccccacgtgcctgagcacctgcagttctccgtggggcaggaggtgttcggg
ctggtgccggggctgatgatgtacgccacgatctggctgcgcgagcacaaccgcgtctgc
gacgtgctcaagcgccagcaccccgagtgggacgacgagcagctcttccagaccacccgc
ctcatactgataggagagacaatcaagatcgttatagaggactatgtgcagcacctgagc
gggtaccacttcaagctgaagtttgaccccgagctgctcttcaaccagaggttccagtac
cagaaccgcatcgcagccgagttcaacacgctgtaccactggcacccattgctgcctgac
accttccacatccacgaccaggagtacaccttccagcagttcctctacaacaactccatc
atgctggaacacggcctctcccatatggtcaaatctttctctaagcaaagtgctggcagg
gttgctggtgggaagaacgttcctgctgcagtacagaaagtggcaaaggcctccattgac
cagagcaggcagatgaggtaccagtccttgaacgagtacaggaaacgcttcatgctgaaa
ccattccgatcctttgaagagcttacaggagaaaaagagatggcagcggagctggaggag
ctgtacggggacatcgatgccatggagctgtacccaggcctgctggtggagaagccccgg
cccggggccatctttggcgagaccatggtggagatcggggcgccgttctccctgaagggg
ctgatgggcaacgccatctgctcccccgagtactggaagcccagcaccttcgggggcaag
gtgggcttcgacatcgtcaacacggcctccctgcagaagctcatctgcaacaacgtgaag
ggctgtcccttcactgccttccacatcctgcctcccgagcccaccgaggccaccattaac
gttagtacctcaaaaactgccatggaggatatcaaccctacactcctgctgaaagagcgc
tctgccgagctatag

DBGET integrated database retrieval system