KEGG   Ficedula albicollis (collared flycatcher): 101816528
Entry
101816528         CDS       T02815                                 

Gene name
TRPV4
Definition
(RefSeq) transient receptor potential cation channel subfamily V member 4
  KO
K04973  transient receptor potential cation channel subfamily V member 4
Organism
fab  Ficedula albicollis (collared flycatcher)
Pathway
fab04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:fab00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    101816528 (TRPV4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:fab04040]
    101816528 (TRPV4)
Ion channels [BR:fab04040]
 Voltage-gated cation channels
  Transient receptor potential channel (TRP)
   101816528 (TRPV4)
SSDB
Motif
Pfam: Ion_trans Ank_2 Ank Ank_3 Ank_4 Ank_5 EspF
Other DBs
NCBI-GeneID: 101816528
NCBI-ProteinID: XP_005055078
UniProt: U3K251
LinkDB
Position
15
AA seq 859 aa
MADTEDAPRDSGEGAGEDGSLQNESFPLSSLANLFESEDTPNPAEAARGPPGAGDGKQNL
RMKFHGAFRKGAPKPMELLEATIYESPVVPAPKKAPMDSLFDYGTYRHHPSENKRWRRRI
AEKQPPAAKGPAPEPPPVLKVFNRPILFDIVSRGSPAGLDGLLSFLLTHKKRLTDEEFRE
PSTGKTCLPKALLNLSGGKNDTIPVLLDIAEKTGNMREFINSPFRDVYYRGQTALHIAIE
RRCKHYVELLVEKGADVHAQARGRFFQPKGEGGYFYFGELPLSLAACTNQPHIVHYLTEN
GHKQADLRRQDSRGNTVLHALVAIADNTRENTKFVTKMYDLLLVKCAKLFPDTNLETLLN
NDGLSPLMMAAKTGKIGIFQHIIRREITDEDARHLSRKFKDWAYGPVYSSLYDLSSLDTC
GEEVSVLEILVYNSKIENRHEMLAVEPINELLRDKWRKFGAVSFYISVVSYLSAMIIFTL
VAYYRPMEGPPPYPYTSTADYLRLAGEIITLLTGILFFCTNIKDLFMKKCPGVNSFFIDG
SFQLLYFIYSVLVIVTAGLYLGGIEAYLAVMVFALVLGWMNALYFTRGLKLTGTYSIMIQ
KILFKDLFRFLLVYLLFMIGYASALVSLLNPCPSSESCSEKSNCTVPTYPSCRDSQTFST
FLLDLFKLTIGMGDLEMLESAKYPGVFIILLVTYIILTFVLLLNMLIALMGETVGQVSKE
SKHIWKLQWATTILDIERSFPVFLRKAFRSGEMVTVGKGTDGTPDRRWCFRVDEVNWSHW
NQNLGIISEDPGKSDTYQYYGFSHTMGRLRRDRWSTVVPRVVELNKSCPVPEEVVVPLGT
LGTAEPREQRHGHAPSSPL
NT seq 2580 nt   +upstreamnt  +downstreamnt
atggcagacaccgaggatgccccgcgcgatagcggggagggcgcgggggaggacggctcc
ctccagaacgaatccttcccgctctcttctctggccaacctgttcgagagcgaggacacc
ccgaaccccgccgaggcagcccggggtccccccggcgccggggatggaaagcaaaacctc
cgcatgaaattccacggggcctttcggaaaggcgccccgaagcccatggagctgctggaa
gccaccatctacgagtcccccgtggtccccgcgcccaagaaagcccccatggattccctc
ttcgactacggcacctaccgccaccaccccagcgagaacaagcgctggcgcaggaggatc
gcggagaagcagccgccagccgcaaagggaccggctcccgagccgccccccgtcctcaag
gtcttcaacagacccatcctcttcgacatcgtctcccggggatccccggccggcctggat
gggctcctctccttccttctcacccacaagaagcgcctcacagacgaggaattccgagag
ccctccacgggaaagacttgcctgcccaaagccctgctcaacctgagcgggggcaagaac
gacaccatccccgtcctgctggacatcgccgagaagacgggaaacatgcgggagttcatc
aactcgcccttcagggacgtctactaccgaggtcagacagcgctgcacatcgccatcgag
cgccgctgcaagcactacgtggagctgctggtggagaagggggcagacgtccatgcccag
gcccgcggccgcttcttccagcccaagggcgagggcggctacttctacttcggtgagctg
cccctctcgctggccgcctgcaccaaccagccgcacatcgtgcactacctgacggagaac
gggcacaagcaggcggacctgcggcgccaggactcccgcggcaacaccgtgctgcacgcc
ctggtggccatcgccgacaacacccgcgagaacaccaagttcgtcaccaagatgtacgac
ctgctcctcgtcaagtgcgccaagctcttccccgacaccaacctggagacgctgctcaac
aacgacggcctctccccgctgatgatggcagccaagaccggcaagatcgggatcttccag
cacatcatccggcgggagatcacggacgaggacgcccggcacctctcccgaaagttcaag
gactgggcatacggccccgtctactcctccctctacgacctctcctcgctggacacctgc
ggggaggaggtgtccgtgctggagattctcgtctacaacagcaagatcgagaaccgccat
gagatgctggctgtggagcccatcaacgagctgctgagggacaagtggcgcaagtttggg
gccgtctccttctacatcagcgtggtctcctacctcagcgccatgatcatcttcaccctc
gtcgcctactaccgccccatggaaggccctccgccctacccctacaccagcaccgccgac
tacctgcgcctggccggggagatcatcaccctcctcactggaatcctcttcttctgcaca
aatatcaaagacctgttcatgaagaagtgcccaggtgtgaactccttcttcatagatggc
tccttccagctgctctacttcatctactcggtgctggtgattgtcacggcagggctgtac
ctgggtggcatcgaggcttacctggctgtcatggtctttgcactggtgctgggctggatg
aatgccctgtacttcacccgtgggctcaagctgacagggacctacagcatcatgatccag
aagatcctcttcaaagacttgttccgtttcctcctggtctacctgctcttcatgattggc
tatgcctcagccctggtgtccctcctcaacccatgtcccagcagtgagtcctgcagtgag
aagtccaactgcacagtgcccacctacccgtcgtgccgggacagccagaccttcagcacc
ttcctgctcgacctcttcaagctcaccatcggcatgggcgacctggagatgctcgagagc
gccaagtacccgggtgtcttcatcatcctccttgtcacctacatcatcctcacctttgtg
ctcctcctcaacatgctcatcgccctcatgggcgagaccgtgggccaagtctccaaggag
agcaagcacatctggaaactgcagtgggccaccaccatcctggacattgagcgctccttc
ccggtgttcctgcggaaagccttccgctcaggggagatggtcactgtgggcaagggcacg
gacgggacccctgaccgccgctggtgcttcagggtggacgaggtgaactggtcccactgg
aaccagaatctgggcatcatcagcgaggacccaggcaagagcgacacgtaccagtactat
ggcttctcccacaccatggggcggctgcggagagatcggtggtcgacggtggtgccacgc
gtggtggagctgaacaagagctgcccagtgccggaggaggtggtggtgcccctggggacc
ctgggcacggcggagccgcgggagcagcggcacggccatgccccgagctccccgctctag

DBGET integrated database retrieval system