KEGG   Ficedula albicollis (collared flycatcher): 101816582
Entry
101816582         CDS       T02815                                 

Gene name
PTGER3
Definition
(RefSeq) prostaglandin E receptor 3
  KO
K04260  prostaglandin E receptor 3
Organism
fab  Ficedula albicollis (collared flycatcher)
Pathway
fab04020  Calcium signaling pathway
fab04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:fab00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    101816582 (PTGER3)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101816582 (PTGER3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:fab04030]
    101816582 (PTGER3)
G protein-coupled receptors [BR:fab04030]
 Rhodopsin family
  Lipid
   Prostaglandin
    101816582 (PTGER3)
SSDB
Motif
Pfam: 7tm_1 PRP38_assoc
Other DBs
NCBI-GeneID: 101816582
NCBI-ProteinID: XP_016155543
LinkDB
Position
8
AA seq 284 aa
PALPILPLAGLGRYALQWPGTWCFISAAGGSAFAAAFAALGLLALVVTGACNLATIGALV
ARCRAKARAAQPGQRWGRIATETLLQLLGIMCVLTACWSPLLITMLRMVAEQAAGPSRGG
ARRWEQQEWHQDCPGCRRPCITMLRMVAEQAAGPSRGGARRWEQHQEWHQEWHQEWHQER
HQEQQEWHQECDLSLTAVRLASLNQILDPWVYLLLRRILLRRFCQAASAVCKGSSTECRD
RDRDRDRHRDRDRDRDGDRDGDRDRDRDRDRDITLSHQICRTAA
NT seq 855 nt   +upstreamnt  +downstreamnt
cccgctcttccgatcttgccgctggccgggctgggccgctacgcgctgcagtggcccggc
acctggtgcttcatcagcgccgccgggggcagcgccttcgccgccgccttcgccgcgctg
gggctgctggccctcgtggtcaccggcgcctgcaacctggccaccatcggggcgctggtg
gctcgctgccgcgccaaggcccgcgcggcgcagcccggccagcgctggggccgcatcgcc
accgagacgctgctgcagctgctgggcatcatgtgcgtgctgaccgcctgctggtcaccg
ctgctgatcaccatgctgaggatggtggcggagcaggcggccgggccgagccggggcggc
gcgcggcgctgggagcagcaggagtggcaccaggactgcccaggctgccgcaggccctgt
atcaccatgctgaggatggtggcggagcaggcggccgggccgagccggggcggcgcgcgg
cgctgggagcagcaccaggagtggcaccaggagtggcaccaggagtggcaccaggagcgg
caccaggagcagcaggagtggcaccaggagtgtgacctgtccctgaccgccgtgcgcctg
gcctccctcaaccagatcctggacccctgggtgtacctgctgctgcgcaggatcctgctg
cgccgcttctgccaggctgccagcgccgtctgcaagggctccagcaccgagtgcagggac
agggacagggacagggacaggcacagggacagggacagggacagggatggcgacagggac
ggggacagggacagggacagggacagggacagggacatcaccctgtcccaccagatctgc
cggaccgcagcctga

DBGET integrated database retrieval system