KEGG   Ficedula albicollis (collared flycatcher): 101816702Help
Entry
101816702         CDS       T02815                                 

Gene name
OGDHL
Definition
(RefSeq) oxoglutarate dehydrogenase-like
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
fab  Ficedula albicollis (collared flycatcher)
Pathway
fab00020  Citrate cycle (TCA cycle)
fab00310  Lysine degradation
fab00380  Tryptophan metabolism
fab01100  Metabolic pathways
fab01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:fab00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    101816702 (OGDHL)
  09105 Amino acid metabolism
   00310 Lysine degradation
    101816702 (OGDHL)
   00380 Tryptophan metabolism
    101816702 (OGDHL)
Enzymes [BR:fab01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     101816702 (OGDHL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: E1_dh Transket_pyr OxoGdeHyase_C 2-oxogl_dehyd_N GGA_N-GAT
Motif
Other DBs
NCBI-GeneID: 101816702
NCBI-ProteinID: XP_005048191
UniProt: U3JW96
LinkDB All DBs
Position
6
AA seq 1012 aa AA seqDB search
MSHLKLFAAVLKSHGIKLLEKQDIARRAFLHGQRYFSSGTSEPFLSGSNSNYVEEMYYAW
LENPKSVHKSWDVFFRSANAGPAAHLPAQQEGKASFLQSHGLAPTPGKAEKLVEDHLAVQ
SLIRAYQIRGHHVAQLDPLGILDADLDSFIPSDLITTIDKLGFYGLHESDLDKVFQLPTT
TFIGGNENSLSLREIIKRLEHTYCQHIGLEFMFINDVEQCQWIRQKFETPGIMKFSNEDK
RTLLARLVRSMRFEDFLARKWSSEKRFGLEGCEVMIPALKTIIDKSSEMGIEYVIMGMPH
RGRLNVLANVIRKELEQIFCQFDPKLEAADEGSGDVKYHLGMYHERINRKTNKKITLSLM
ANPSHLEAVDPVVQGKTKAEQFYRGDTAGKKVMSILLHGDAAFAGQGVVYETFHLSDLPS
YTTNGTIHVVVNNQIGFTTDPRMARSSPYPTDVARVVNAPIFHVNADDPEAVMYVCNVAA
EWRNTFNKDVVVDLVCYRRRGHNEMDEPMFTQPLMYKQIHKQVPVLKKYADKLIADGTVT
LQEFEEEIAKYDRICEEAYTRSKDKKLLHIKHWLDSPWPGFFNADGEPKSMSCPPTGISE
EMLTHIGNVASSVPVEDFKIHSGLSRILKARSEMTKDRLVDWALAEYMAFGSVLKEGIHV
RLSGQDVERGTFSHRHHVLHDQEVDKRICVPMNHLWEQQAPYTVCNSSLSEYGVLGFELG
FAMASPNALVCWEAQFGDFHNTAQCIIDQFISCGQAKWVRHNGIVLLLPHGMEGMGPEHS
SARPERFLQMSNDDSDAYPEFTEQFEVSQLYECNWIVVNCSTPANYFHVLRRQILLPFRK
PLIVLTPKSLLRHPEAKSSFDEMVSGTTFQRVIPENGPAAQAPHEVKRVIFCTGKVYYDL
VKERKSQDLEKQVAITRLEQISPFPFDLLKEEVDKYPTADLVWCQEEHKNSGYYDYVKPR
FRTIVNHTRPIWYVGREPAAAAATGNKNMHLVSLRRFLDTAFNLEAFEGKTF
NT seq 3039 nt NT seq  +upstreamnt  +downstreamnt
atgagtcatctgaagttgtttgcagctgtactgaagagtcatggcattaaacttctggaa
aagcaggatatagccagaagggcatttttacatggccaacggtatttttcatcaggaacc
tcagagccattcctgagtgggagtaattccaattatgtggaggaaatgtactatgcatgg
cttgaaaaccctaaaagtgtacataagtcgtgggatgtgtttttccgaagtgctaacgct
ggcccagcagcccatctgccagctcagcaggaaggaaaggcatcatttctgcagagccac
ggcctggcccccacaccagggaaggctgaaaagcttgttgaagaccaccttgctgtgcag
tccttgataagagcataccaaatccgtggccatcatgtggctcagctagatcctcttgga
attctggatgcagatttggattcatttattccatctgaccttattaccacaattgacaaa
cttgggttttatggtttgcatgaatcagatttggacaaagtctttcagctgccaacaacc
accttcataggaggaaatgagaacagtctgtctttgcgagagatcatcaaacgcctggag
catacatactgccaacacattggcctggagttcatgttcatcaatgatgtggagcagtgc
cagtggatccgccagaagtttgagacgccgggaattatgaagttctcgaacgaggataaa
aggactttgctggcaaggctggtgcgctccatgagatttgaagacttccttgctcgcaag
tggtcttctgaaaagagatttggtttggaaggatgtgaagtaatgattcctgcacttaag
accatcattgataaatccagtgaaatgggaattgaatatgttattatgggaatgcctcac
agaggtcggttgaatgtattggctaatgtaatccgaaaagagctggaacagatattctgt
cagtttgatcccaaacttgaagcagctgatgagggatctggggatgtaaaataccacctg
ggaatgtaccatgaaaggatcaacagaaaaacaaacaagaaaatcactctgtccctgatg
gctaacccttctcacttggaagcagttgatcctgttgtgcaaggcaaaacaaaagctgaa
cagttttatcgaggggatacggcagggaaaaaggttatgtccatattattacatggggat
gctgcctttgcaggacaaggagtggtttatgagacatttcatctcagtgacctcccatcc
tacaccaccaatggcactattcatgtggtggtcaacaaccagattggcttcaccacagac
ccccgtatggcccgttcatctccgtatcccacggatgttgctcgtgtggtcaatgctccc
attttccacgtgaatgctgatgaccctgaagcagtgatgtacgtgtgcaatgtcgctgca
gagtggcggaacactttcaacaaggatgtggttgttgacttggtttgttaccgtaggaga
gggcacaatgaaatggatgagcccatgttcacccagcctctgatgtacaagcagatccat
aagcaggtgccagtgctgaagaagtacgctgacaaactgattgcagatgggactgtgaca
ctgcaggagtttgaggaagaaattgcaaagtatgatagaatatgtgaagaagcatatact
agatctaaagataagaagctccttcatatcaagcactggctggattcaccttggcctggc
ttctttaatgcagatggagagcccaagagcatgtcttgtcctccgacgggcatttcggag
gagatgctgactcacattggcaatgtcgctagttcagtgcctgttgaagacttcaaaata
cactcaggactctctcggattttgaaagctcgctcggaaatgaccaaggacaggcttgtt
gactgggccttagcagagtacatggcttttggctctgttctcaaagaagggatccatgtc
cgactaagtgggcaggatgtggagagaggtactttcagccatcgtcaccatgtgcttcat
gatcaagaggttgacaagagaatttgtgttcccatgaatcacctctgggagcagcaggcc
ccctacacagtgtgcaacagttccctctccgagtacggggtcctaggttttgaacttggc
tttgctatggcgagtcccaacgccctggtgtgctgggaagcccagtttggggacttccac
aacacagctcagtgcataatagaccagttcatcagctgcggccaggccaagtgggtccgg
cacaacgggatcgtcctgctcctgccccacgggatggaaggaatgggtccagagcattca
tcagccaggcctgaaaggtttctgcagatgagcaatgatgattctgatgcctatccagag
ttcactgagcagtttgaagtttcccagctgtatgaatgtaactggattgtggtgaattgt
tcaactccagccaattactttcatgtcctccgaaggcagatcttgctgccattcagaaag
ccgctgattgttttgacacccaagtcattgctgaggcatccagaagctaaatccagtttt
gatgaaatggtgtctggtaccactttccaacgtgtgatccctgagaatgggccagcagct
caggcaccacatgaggtcaagcgagtcattttctgcacaggaaaagtctactatgacctt
gtaaaagagagaaagagccaagacctggagaaacaagtagctataaccagacttgaacag
atctcaccattcccctttgacttgctgaaagaagaagttgataagtatccaactgctgat
ctagtctggtgtcaggaggagcacaagaacagcggatattatgactatgtcaaacctcgt
ttccgcactatcgtgaaccacactcggccaatctggtatgttggccgagagcctgctgct
gcagctgctacaggcaacaagaacatgcatctggtgtcactcaggaggttcttggataca
gctttcaacctggaggcctttgagggaaagacattctaa

DBGET integrated database retrieval system