KEGG   Ficedula albicollis (collared flycatcher): 101816817Help
Entry
101816817         CDS       T02815                                 

Gene name
CDC25A
Definition
(RefSeq) cell division cycle 25A
  KO
K06645  M-phase inducer phosphatase 1 [EC:3.1.3.48]
Organism
fab  Ficedula albicollis (collared flycatcher)
Pathway
fab04110  Cell cycle
fab04218  Cellular senescence
fab04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:fab00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101816817 (CDC25A)
   04218 Cellular senescence
    101816817 (CDC25A)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    101816817 (CDC25A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:fab01009]
    101816817 (CDC25A)
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:fab03400]
    101816817 (CDC25A)
Enzymes [BR:fab01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     101816817 (CDC25A)
Protein phosphatases and associated proteins [BR:fab01009]
 Protein tyrosine phosphatases (PTPs)
  Class III PTPs
   CDC25s
    101816817 (CDC25A)
DNA repair and recombination proteins [BR:fab03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    101816817 (CDC25A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: M-inducer_phosp Rhodanese
Motif
Other DBs
NCBI-GeneID: 101816817
NCBI-ProteinID: XP_016151633
LinkDB All DBs
Position
2
AA seq 517 aa AA seqDB search
MDPTPSASHRRRLLLLSPASPASPAVVKALFQDELSPVSDLRLTMEQLGRGQRENLDQDV
GTKNGLHRSASSESTDSGLALDSPGPATSHDTMEDTFEKAIKSSKLNLRIPFRRIHSLPQ
SLLGSSPALKRNHSDSLDTDAFQPLEQDENKENESFEFKKPTKPASRGFRDGRGVAARQN
SSPAQLPMGEPASGEQENSRAAFLQQHSLPSSESEDDDGFLELLDDQDLKNDEEMPSDVS
SLWTAPLVMRRAENRAKRCRLFGSSSMSGIAGRTTQKRMERSQEENSPGKSKKRRSLPGT
SEDSTCLKLVRTQPSTAEIESILDSDQRDLIGDFSKSYLFDTVDGKHQDLKYIDSEMIVS
VLTGKFESFIKQCVIIDCRYPYEYEGGHIKGAINLHMEEEVEDFLLKKPIQPSENKRVIV
VFHCEFSSERGPRMCRFVREQDRLSNEYPNLHYPELYVLKGGYKDFFSRCQSFCEPQSYR
PMHHKDFKEDLKRFRTKSRTWAGEKSKREMYSRLKKL
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atggatcccaccccgagcgcctctcaccgccgccgcctcctgctcctctcgccggcgtcg
cccgcctcgcccgccgtggtgaaggcgctctttcaggatgagctctcgcctgtctcggat
ctccgcctcaccatggagcagctggggcgcgggcagcgtgaaaacctggaccaagacgtg
ggaaccaaaaatggattacacagatcagcgtcttcagagtccacagactcaggtttggct
ttggattctcctggccctgccacctcacacgacaccatggaggacacgtttgagaaagca
atcaaatccagcaagctgaaccttcgaatacctttcagaagaatccattctctgccacaa
agcctgctgggctccagccctgctctgaagagaaaccactctgactctctggacactgat
gctttccagcctttggagcaggatgaaaacaaggaaaacgaatcatttgagtttaaaaag
ccaaccaagccagcttctcgtggcttccgtgatgggaggggtgttgcagcaaggcagaat
tcatctccagctcagctgcccatgggggaaccagcctcaggggagcaggagaactccagg
gcagccttcctgcagcagcattccctgccctcctcggagagtgaggatgatgatggcttc
ctggagctgctggatgaccaggacctgaagaacgatgaggagatgccctcagacgtgtcc
agcctctggacggcgccgctggtcatgaggagagcggagaaccgggccaagaggtgccgg
ttgtttggctcttcatccatgtcaggcattgcaggaagaaccacccagaaaaggatggag
agatcccaggaggagaattctccagggaaaagcaagaagaggagaagcctgcctggaact
tctgaggactccacgtgtctgaagctggtgaggacccagccctccacagcagagatcgag
agcattttggacagtgaccagagggaccttattggggacttctccaagagttacttattt
gacactgtcgatgggaaacatcaagatttaaaatacatcgactcagaaatgattgtgtct
gtgctgactgggaagtttgagagcttcatcaagcagtgtgtgataattgactgtagatac
ccctatgagtatgaagggggacacatcaagggtgccataaacctgcacatggaggaggag
gtggaggatttcctgctgaagaagccgatccagccgtcggagaacaagcgggtgatcgtg
gtgttccactgcgagttctcctcggagcggggccctcgcatgtgccggtttgtgagggag
caggacaggctgagcaatgagtaccccaacctgcactacccagagctctacgtgctcaag
gggggctacaaggatttcttctccaggtgccagagcttctgtgagccccagagctacagg
cccatgcaccacaaggacttcaaggaggacctgaagaggttccgcaccaagagccgcacc
tgggccggcgagaagagcaagagggagatgtacagtcgcctcaagaagctctga

DBGET integrated database retrieval system