KEGG   Ficedula albicollis (collared flycatcher): 101816833Help
Entry
101816833         CDS       T02815                                 

Gene name
GSTZ1
Definition
(RefSeq) glutathione S-transferase zeta 1
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
fab  Ficedula albicollis (collared flycatcher)
Pathway
fab00350  Tyrosine metabolism
fab01100  Metabolic pathways
Module
fab_M00044  Tyrosine degradation, tyrosine => homogentisate
Brite
KEGG Orthology (KO) [BR:fab00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    101816833 (GSTZ1)
Enzymes [BR:fab01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     101816833 (GSTZ1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_3 GST_C GST_C_2 Tom37 Glutaredoxin
Motif
Other DBs
NCBI-GeneID: 101816833
NCBI-ProteinID: XP_005047549
LinkDB All DBs
Position
5
AA seq 215 aa AA seqDB search
MASEKPILYSYFRSSCSWRVRIALALKGISYDLVPVNLIKDGGQQFSAEFKALNPMQQVP
ALKIDGITISQSLAIINYLEETHPNPRLLPQDPKKRAQVRMIADHIASGIQPLQNLSVLK
QMGEKKMEWAQNCITSGFQALEQILQHTAGLYCVGDEVSVADLCLVPQVANAERFKVDMG
PYPTITKINKALLELEAFKISHPSRQPDTPAELRA
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atggcatctgaaaagccaatactttacagctatttccgaagttcctgttcttggagagtg
cgaatcgcactggctctgaaaggaatttcctatgacctggtcccagtgaacctcattaag
gatggaggacagcagttttctgctgaattcaaggcactgaatcctatgcagcaagtccca
gccttgaaaatcgatggcatcaccatttctcagtcactagctataattaattacctagaa
gagacacatcctaaccccaggctcctgccccaagatccaaagaagagagcccaagtcaga
atgatcgctgatcacattgcctctggcatccaaccactccagaacctgagtgtcctgaaa
caaatgggggagaaaaaaatggaatgggctcagaactgtatcacatctggctttcaagca
ctggagcagattctgcagcacactgctggactctactgtgtgggggatgaagtttccgtg
gctgatctgtgtttagtgcctcaagtggccaatgctgaaagattcaaagtggacatgggt
ccatatcccacaataaccaaaataaataaagctctcttggagttagaggccttcaaaata
agccacccttcccggcagccagatactcctgcagagctgcgagcttga

DBGET integrated database retrieval system