KEGG   Ficedula albicollis (collared flycatcher): 101817487Help
Entry
101817487         CDS       T02815                                 

Gene name
WBSCR17
Definition
(RefSeq) Williams-Beuren syndrome chromosome region 17
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
fab  Ficedula albicollis (collared flycatcher)
Pathway
fab00512  Mucin type O-glycan biosynthesis
fab01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fab00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    101817487 (WBSCR17)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:fab01003]
    101817487 (WBSCR17)
Enzymes [BR:fab01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     101817487 (WBSCR17)
Glycosyltransferases [BR:fab01003]
 O-Glycan biosynthesis
  Mucin-type
   101817487 (WBSCR17)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin Glyco_tranf_2_3 RicinB_lectin_2 Glyco_transf_7C
Motif
Other DBs
NCBI-GeneID: 101817487
NCBI-ProteinID: XP_005056449
UniProt: U3KHB5
LinkDB All DBs
Position
19
AA seq 598 aa AA seqDB search
MASLRRVKVLLVLNLIAVAGFVLFLAKCRPITTKSGDSFHDIHPRAEVANLTAHGISSIQ
DAVLKRLSLLEDIVYRQLNGLSKSLGLIEGYGGRGKGGLPATLSPEEEEKAKGPHEKYGY
NSYLSEKISLDRSIPDYRPTKCKELKYGKDLPQISIIFIFVNEALSVILRSVHSAVNHTP
APLLKEIILVDDNSDEEELKAPLEEYVNKRYPGLVKVVRNQKREGLIRARIEGWKAATGQ
VTGFFDAHVEFTAGWAEPVLSRIQENRKRVILPSIDNIKQDNFEVQRYENSAHGYSWELW
CMYISPPKDWWDAGDPSLPIRTPAMIGCSFVVNRKFFGEIGLLDPGMDVYGGENIELGIK
VWLCGGSMEVLPCSRVAHIERKKKPYNNNIGFYTKRNALRVAEVWMDDYKWHVYIAWNLP
LENPGIDIGDVSERKALRKSLKCKNFQWYLDHVYPEMRRYNNTIAYGELRNNKAKDVCLD
QGPQENHTAILYPCHGWGPQLARYTKEGFLHLGALGTTTLLPDTRCLVDTGKSRFPQLLD
CDKVKSSLHKRWNFIQNGAILNKGTGRCLEVENRGMAGIDLILRSCTGQRWTIKNFIK
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atggcttctttgcggagagtcaaagtgctgctggtgttaaacctgatcgccgtggctggc
ttcgtcctcttcctggccaagtgcagacccatcacgaccaagagcggcgactccttccat
gacatccatcccagggcagaagtggccaacttgacagcccacggcatcagctccatccag
gatgcagtgctgaagaggctctcgctcctagaagacatagtctacaggcagctgaatggt
ctgtccaagtcccttggtctcattgagggctatggtggccgtggcaagggtggcctccca
gccaccctgtcccctgaggaggaggagaaagccaagggaccccatgagaagtatggctac
aactcctacctcagtgagaagatctccctggaccgttccatcccggattatcgcccaacc
aagtgcaaggagctgaagtacgggaaggacctgccgcagatctccatcatcttcatcttt
gtgaacgaggcgctgtcggtgatcctgcgctcggtgcacagcgctgtcaaccacaccccc
gcccccctgctcaaggagatcatcctggtggacgacaacagtgatgaggaggagctgaag
gcgccgctggaggagtacgtcaacaagcgctacccggggctggtgaaggtggtgaggaac
cagaagagggaggggctgatccgggcccgcatcgagggctggaaagctgccactggccag
gtcaccggcttcttcgatgcccacgtggagttcactgctggctgggcagagcccgtgctc
tcccggatccaggagaacaggaagagggtgatcctgccctccatcgacaacatcaagcag
gacaacttcgaggtgcagcgctacgagaactcggcccacggctacagctgggagctgtgg
tgcatgtacatcagcccccccaaggactggtgggacgccggggacccctccctgcccatc
aggacccctgccatgatcggctgctccttcgtggtaaacaggaaattctttggggagatt
gggctgctggaccccggcatggacgtgtatggaggggagaacatcgagctgggcatcaag
gtgtggctgtgcgggggcagcatggaggtgctgccctgctcgcgggtggcgcacatcgag
cgcaagaagaagccctacaacaacaacatcggcttctacaccaagcgcaacgcgctgcgc
gtggccgaggtctggatggacgactacaagtggcacgtctacatcgcctggaacctgccc
ctggagaatccagggattgacattggggatgtgtctgagaggaaagccttgaggaagagc
ctgaagtgtaaaaatttccagtggtacctggaccatgtttatccagaaatgaggagatac
aacaacaccattgcttatggagagctgcggaacaacaaggccaaggacgtgtgtctggac
cagggcccccaggagaaccacacagcaattctgtacccgtgccatggctggggcccacag
ctggcccgctacaccaaggagggtttcctgcacctgggggccctgggcaccaccacgctg
ctgcccgacacgcgctgcctggtggacacgggcaagagccgcttcccgcagctgctggac
tgcgacaaggtcaagagcagcctgcacaagcgctggaacttcatccagaacggagccatc
ctgaacaaggggacgggccggtgcctggaggtggagaacaggggcatggctggcatcgac
ctgatccttcgcagctgcacagggcagaggtggacaattaaaaacttcatcaagtag

DBGET integrated database retrieval system