KEGG   Ficedula albicollis (collared flycatcher): 101817673
Entry
101817673         CDS       T02815                                 

Gene name
FGF1
Definition
(RefSeq) fibroblast growth factor 1
  KO
K18496  fibroblast growth factor 1
Organism
fab  Ficedula albicollis (collared flycatcher)
Pathway
fab04010  MAPK signaling pathway
fab04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:fab00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101817673 (FGF1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101817673 (FGF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:fab04052]
    101817673 (FGF1)
   00536 Glycosaminoglycan binding proteins [BR:fab00536]
    101817673 (FGF1)
Cytokines and growth factors [BR:fab04052]
 Growth factors
  Growth factors (RTK binding)
   101817673 (FGF1)
Glycosaminoglycan binding proteins [BR:fab00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   101817673 (FGF1)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 101817673
NCBI-ProteinID: XP_005053762
UniProt: U3K2T7
LinkDB
Position
13
AA seq 155 aa
MAEGEITTFTALTEKFDLPAGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQ
LSAESVGVVHIKSTQSGQYLAMDTNGLLYGSQLLGEECLFLERLEENHYNTYVSKLHADK
SWFVGLKKNGNSKLGPRTHYGQKAILFLPLPVSPD
NT seq 468 nt   +upstreamnt  +downstreamnt
atggccgagggggaaatcaccaccttcaccgcgctgacagagaagttcgacttgcccgcg
ggcaactacaagaagcccaaactgctgtactgcagcaacggggggcacttcctgcgcatc
ctgcccgacggcaccgtggatggcacccgcgaccgcagcgaccagcacattcagctccag
ctgagtgcagagagcgtgggggtggtgcacatcaagagcacgcagtcggggcagtacctg
gccatggacaccaacgggctcctctacggctcgcagttactgggtgaggagtgcctgttc
ctggaaaggctggaggaaaaccattacaacacctacgtgtccaagctgcacgcggacaag
agctggtttgtggggctgaagaagaacgggaacagcaagctgggcccgcggactcactac
ggccagaaggcgatcctgttcctgcccctgcccgtctcacccgactga

DBGET integrated database retrieval system