KEGG   Ficedula albicollis (collared flycatcher): 101818603
Entry
101818603         CDS       T02815                                 

Gene name
PTGFR
Definition
(RefSeq) prostaglandin F receptor
  KO
K04262  prostaglandin F receptor
Organism
fab  Ficedula albicollis (collared flycatcher)
Pathway
fab04020  Calcium signaling pathway
fab04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:fab00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    101818603 (PTGFR)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101818603 (PTGFR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:fab04030]
    101818603 (PTGFR)
G protein-coupled receptors [BR:fab04030]
 Rhodopsin family
  Lipid
   Prostaglandin
    101818603 (PTGFR)
SSDB
Motif
Pfam: 7tm_1 Serpentine_r_xa
Other DBs
NCBI-GeneID: 101818603
NCBI-ProteinID: XP_005050291
UniProt: U3JTD1
LinkDB
Position
8
AA seq 364 aa
MNSSKSPGLAGFGVLKNSTCHTEKKISVFFSIIFMTAGILSNSLAIVILMKAYQRFRQKS
KASFLLLASGLVVTDLFGHLINGAIAVFVYASDKDWIRFNQSNILCSVFGICMVFFGLCP
LFLGSVMAVERCIGVTKPIFHSTKMTSRHVKMMLTMVCLFAVLIALLPILRFRAYQIQAS
RTWCFYKTEHVEDWEDRFYLLLFSCLGFLALAISFLCNAVTGITLLRVKFKSQQRQGRSH
HFEMIIQLLAIMCVSCICWSPFLVTMARIGINEGGSKETCETILFALRMATWNQILDPWV
YILLRKAVLKNLYKITSGCCGVHVINLHMWELSSIKNSLKVAAISESPGSSKQINLQPLS
SMGQ
NT seq 1095 nt   +upstreamnt  +downstreamnt
atgaacagttcaaaatcaccagggctggctggatttggagtcttgaaaaactcaacgtgc
cacacggagaaaaagatttcagttttcttttccataatcttcatgacggcgggaattttg
tccaacagtcttgcaatagtaattctcatgaaggcataccagagattcagacagaaatca
aaagcctcctttttgcttcttgccagtggcttggttgtcacagatctctttggtcacctc
atcaatggagccattgcagtgtttgtgtacgcatcagataaagactggattcgatttaac
cagtccaacattctgtgcagtgtttttggcatctgcatggttttctttggtttgtgccca
ctcttcctgggcagtgtgatggctgttgaacggtgcattggagtcactaagccaatattt
cactctacaaaaatgacttctagacatgtgaaaatgatgttgactatggtatgtctgttt
gctgttcttatagctttgctgcctattcttaggtttagagcctaccaaattcaagcatcg
aggacctggtgcttctataaaacagaacatgttgaggactgggaagacagattttatctc
ttacttttttcttgccttgggttcctggcccttgctatttcattcctgtgcaatgctgtc
acaggaattaccctcttaagagtcaaatttaaaagtcaacaaagacaaggcagatctcat
cattttgaaatgatcattcagctcttggctataatgtgtgtttcttgcatttgctggagc
ccgttcctggtgacaatggccaggattgggataaatgaaggtggctcaaaggagacctgt
gaaacgatactttttgctctccgaatggccacgtggaaccagattttagacccctgggtg
tacattctgctccggaaggctgttctcaaaaacctgtacaagatcaccagtgggtgctgt
ggtgtgcatgtcataaacttacacatgtgggaactcagctccatcaagaattccctgaag
gttgcagcaatatcagagtcaccaggaagttccaaacagataaacctccagcctctcagc
tctatgggacaataa

DBGET integrated database retrieval system