KEGG   Ficedula albicollis (collared flycatcher): 101818835Help
Entry
101818835         CDS       T02815                                 

Gene name
CDK14
Definition
(RefSeq) cyclin dependent kinase 14
  KO
K08821  cyclin-dependent kinase 14 [EC:2.7.11.22]
Organism
fab  Ficedula albicollis (collared flycatcher)
Brite
KEGG Orthology (KO) [BR:fab00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fab01001]
    101818835 (CDK14)
Enzymes [BR:fab01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     101818835 (CDK14)
Protein kinases [BR:fab01001]
 Serine/threonine kinases: CMGC group
  CDK family
   101818835 (CDK14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase Kinase-like APH
Motif
Other DBs
NCBI-GeneID: 101818835
NCBI-ProteinID: XP_005040888
LinkDB All DBs
Position
2
AA seq 453 aa AA seqDB search
MRPLGSHPGELPQQHCLRFVNTREKICVTKMSTRNCQGMDSVIKPLDTIPEDKKVRVQRT
QSSFDPFEKPANQVKRVHSENNACINFKTSSAGKESPKVRRHSSPSSPTSPKFGKADSYE
KLEKLGEGSYATVYKGKSKVNGKLVALKVIRLQEEEGTPFTAIREASLLKGLKHANIVLL
HDIIHTKETLTLVFEYVHTDLCQYMDKHPGGLHPENVKLFLFQLLRGLSYIHQRYILHRD
LKPQNLLISDTGELKLADFGLARAKSVPSHTYSNEVVTLWYRPPDVLLGSTEYSTCLDMW
GVGCIFVEMIQGVAAFPGMKDIQDQLERIFLVLGTPNEDTWPGVHSLPHFKPERFTQYSP
KNLRQAWNKLSCVNHAEDLASKLLQCFPKNRLSAQAALSHEYFSDLPPRLWELTDMSSIF
TVPNVRLQPETGESMRAFGKNNSYGKGVSNSKH
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgagacctctcggcagccaccctggtgagcttccccagcagcactgcctgcggtttgta
aataccagggaaaagatatgtgtcacaaagatgtctacacggaactgccagggaatggat
tcagtgatcaaacctctggatacaattcctgaggataaaaaagttcgggttcagaggaca
cagagtagttttgatccatttgagaagccagctaatcaagtgaagagggttcattcggag
aacaacgcctgcattaacttcaaaacttcatctgcagggaaggaatcaccgaaagtcagg
cggcactccagccccagctctcctacaagccccaagtttggaaaagcagactcatatgaa
aaactggaaaaactaggggaagggtcctatgctacagtatacaaaggaaaaagcaaggta
aatggaaagctggtggcattgaaggtgattagattacaagaagaggaaggaaccccattt
actgctatcagggaagcttctcttttgaaaggattgaaacatgcaaacattgtgctgctc
catgacatcattcacaccaaggagactttgacgcttgtgtttgaatatgtgcacactgat
ttatgtcagtacatggacaaacaccctggagggcttcatccagagaatgtgaagttattt
ttatttcagttgctgcgaggactgtcttacatccaccagcgttacattttgcacagggac
ctgaaaccacagaaccttctgatcagtgacacgggggagttaaagctggcagactttggt
cttgcaagagctaaatcagttcctagtcatacatattccaatgaagtggtaaccctatgg
tacaggcctccagatgtccttctgggatcaacagaatattccacctgccttgacatgtgg
ggagtgggttgtatctttgtagaaatgattcaaggggtcgctgcttttccaggaatgaaa
gacattcaagatcaacttgaaaggatatttctggtactcgggacaccaaatgaagatacg
tggcctggagtccactctttaccccatttcaaaccagaacggtttacacaatacagccct
aaaaaccttagacaagcatggaacaagctgagctgtgtgaaccatgcagaggatctagcc
tccaaactactccaatgtttcccaaagaacagattgtcagcacaggcagctctgagccac
gagtacttcagtgatctgcccccacggctatgggagttaactgatatgtcttctattttt
actgtaccgaatgtaagattacagccagagactggagaaagcatgagagcctttggaaaa
aacaatagttatggcaaaggtgtatcaaacagcaaacattga

DBGET integrated database retrieval system