KEGG   Ficedula albicollis (collared flycatcher): 101819593Help
Entry
101819593         CDS       T02815                                 

Gene name
ACE
Definition
(RefSeq) angiotensin I converting enzyme
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
fab  Ficedula albicollis (collared flycatcher)
Brite
KEGG Orthology (KO) [BR:fab00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:fab01002]
    101819593 (ACE)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fab04147]
    101819593 (ACE)
   04090 CD molecules [BR:fab04090]
    101819593 (ACE)
Enzymes [BR:fab01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     101819593 (ACE)
Peptidases [BR:fab01002]
 Metallo Peptidases
  Family M2
   101819593 (ACE)
Exosome [BR:fab04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101819593 (ACE)
CD molecules [BR:fab04090]
 Proteins
  101819593 (ACE)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M2 Ku_PK_bind Peptidase_M32
Motif
Other DBs
NCBI-GeneID: 101819593
NCBI-ProteinID: XP_016159797
LinkDB All DBs
Position
27
AA seq 1265 aa AA seqDB search
GAGALRPGLEPPQFDTSEEGAAQFARSYNDTAELVFFDSVSASWNYNTNLTAENAALQVQ
ASLEEQNFTELWGKKAKELYGNRWHNFSDPQLRKIIGSIQTLGPSNLPLEEREQYNTILS
DMDKIYSTAKVCLSNSTCWDLEPDLSDIMATSRSYRKLLFAWEGWHNAAGNPLRPKYETF
VELSNAAYSMDGFNDTGSYWRSWYNSDSFERDLEHIYNQLEPLYLNLHAFVRRKLYERYG
PKYINLKGPIPAHLLGNMWAQQWNNIYDLMIPFPEKPNLDVTSTMVQQGWNATHMFRVSE
EFFTSLGLLDMPPEFWNESMLEKPSDGREVVCHASAWDFYNRKDFRIKQCTSVTMEQLFT
VHHEMGHIQYYLQYKEQPVPFRSGANPGFHEAIGDVLSLSVSTPKHLKEIGLLSSATEDE
ESNINYLLKMALEKIAFLPFGYLIDQWRWNVFSGRTPPSRYNYDWWYLRTKYQGICAPVP
RNESNFDPGAKYHIPGNTPYIRYFVSFILQFQFHKALCEAANHTGPLHTCDIYRSKEAGD
KLREVLKAGSSKSWQDILLNLTGTGEMDAGPLLEYFSPVTKWLQEQNNKTNEVLGWPEFD
WRPPVPEGYPEGIDKIADEAQAKEFLSEYNRTAEEVWEAYTEASWAYNTNITDHNKEVML
EKNLAMSKHTLEYGMRARQFDTSDFQDQSVTRILKKLSVIERAALPEDELKEYNTLLSDM
ETTYSVAKVCREDKTCHPLDPDLTDIMATSRDYNELLFAWKGWRDASGKKMRNSYKRYVE
LSNKAATLNGYKDNGAYWRSLYETSTFEEDLERLYLQLQPLYLNLHAYVRRALYKKYGAE
HINLRGPIPAHLLGNMWAQSWSNIFDLVIPYPDATKVDATPAMKKQGWTPKKMFEESDRF
FTSLGLIPMPQEFWDKSMIEKPSDGREVVCHASAWDFYNRKDFRIKQCTVVNMDDLITVH
HEMGHVQYFLQYKEQPVSFRDGANPGFHEAVGDVMALSVSTPKHLHSINLLEQVTENQES
DINYLMSIALDKIAFLPFGYLMDQWRWKVFDGRIKEDEYNKEWWNLRMKYQGLCPPALRS
EDDFDPGAKFHIPANVPYIRYFVSFVIQFQFHQALCDAAGHKGPLHTCDIYQSKEAGKIL
GDALKLGFSKPWPEAMQLITGQPNMSAEALMSYFEPLMTWLEKENSKNGEVLGWPEYSWT
PYAAQDDSSRTDFLGMSLTKSQATAGGWVLLALALIFLITTIFLGVKFFSARRKAFKSSS
EMELK
NT seq 3798 nt NT seq  +upstreamnt  +downstreamnt
ggggcgggcgccctccgccccggcctcgagcccccccagttcgacaccagcgaggagggg
gccgcccagttcgccaggagctacaacgacacggccgagctcgtcttcttcgacagcgtc
tcggccagctggaattacaacaccaacctgacggccgaaaatgccgctctgcaggtccag
gcgtcactggaggagcagaacttcacagagctctgggggaagaaagccaaggaactctat
ggcaacagatggcataacttcagtgacccccagctgaggaaaatcattggatccatccag
accttgggaccctccaacctgcccctggaggagagagagcagtacaacacgatcctgagc
gacatggacaaaatctactccacggccaaggtgtgcctgtccaacagcacctgctgggat
ctggagccagacctgtcggacatcatggccacctcccgcagctacaggaagctgctcttc
gcctgggagggctggcacaacgccgcggggaacccgctgcgccccaagtacgagaccttc
gtggagctgagcaacgccgcctactccatggacggattcaatgatacaggcagctactgg
cgctcctggtacaactccgactcctttgagagggacctggagcacatctacaaccagctg
gagccactctacctcaacctgcacgccttcgtccggaggaagctgtacgagcgctacggg
cccaaatacatcaacctgaagggtcccatccctgctcacctcctagggaacatgtgggct
cagcagtggaacaacatctatgacctgatgatccccttccccgagaagcccaaccttgat
gttacgagcaccatggtgcagcagggctggaatgccacccacatgttccgggtctcggag
gagttcttcacctccctggggctcctggacatgccccctgaattctggaacgagtccatg
ctggaaaagccgtcggacgggcgggaggtggtgtgccacgcctcggcctgggacttctac
aaccgcaaggacttcaggatcaagcagtgcacgtcggtgaccatggagcagctgttcacc
gtgcaccacgagatgggccacatccagtactacctgcagtacaaggagcagcccgtgccc
ttccgcagcggcgccaaccccggcttccacgaggccatcggcgacgtcctgtccctctcc
gtttccacccccaaacacctcaaggagatcggtctgctcagcagtgccactgaggatgaa
gagagcaatatcaactacctgctgaagatggccctggagaagattgcctttctgcccttt
ggctacctcatcgaccagtggcgctggaacgtgttcagtggccgcacgccaccgagccgc
tacaactacgactggtggtacctgagaaccaaataccaggggatctgcgctccagttcca
aggaacgaaagcaactttgaccctggagcaaagtaccacatcccagggaacactccttac
atcaggtactttgtgagcttcatcctccagttccagtttcacaaggcactgtgcgaggca
gccaaccacaccggtcccctgcacacctgtgacatctacaggtccaaagaggctggagac
aaactcagggaagtgttgaaagccgggtcctcgaagtcgtggcaggatatcctcttgaat
ctcactggcacgggtgagatggatgctggtccccttctggaatatttcagccctgtcacc
aagtggcttcaggagcagaacaacaagaccaatgaggtgctgggctggcctgagttcgac
tggcgtccccctgtccctgaaggctaccctgaaggcattgacaaaatagcagatgaggca
caagctaaagagttcttgtccgagtacaacaggacagctgaggaagtgtgggaagcctac
accgaggcatcctgggcctacaacaccaacatcaccgaccacaacaaggaggtcatgctg
gagaagaacttggccatgtccaagcacaccctggagtacggcatgagggccaggcagttt
gacacctctgatttccaggaccagagtgtcacccgcatcctcaagaagctgagtgtcatt
gagagggcagccctacctgaggacgagctgaaggagtataacaccctcctctccgatatg
gagaccacgtacagcgtggccaaggtctgcagagaggacaaaacctgccacccactggac
cctgacctcacagacatcatggccacctctcgggactacaacgagctcctgtttgcctgg
aagggctggcgggatgcttcggggaagaagatgaggaacagctacaagcgatacgtggaa
ctgagcaacaaggcagccacgctcaacggctacaaagacaacggggcctactggagatcc
ctgtatgagacatccaccttcgaggaggatctggagaggctgtacctgcagctgcagccc
ctgtacctcaacctgcacgcttacgtacgccgagccctctacaagaagtacggggcagag
cacataaacctgcggggtcccatccctgcccacctgctgggcaacatgtgggctcagtca
tggtccaacattttcgacctggtcataccttacccagatgccaccaaggtggatgccacc
ccggccatgaaaaagcagggctggacacccaagaaaatgttcgaagagtcggaccgtttc
ttcacctctctggggctcatccccatgccacaggagttctgggacaagtccatgatcgag
aagccgtcggacgggcgggaggtggtgtgccacgcctcggcctgggacttctacaaccgc
aaggacttcaggatcaagcagtgcaccgtggtgaacatggacgacctgatcaccgtgcac
cacgagatgggccacgtgcagtatttcctgcagtacaaggagcagcccgtgtccttccgc
gacggcgccaaccccggcttccacgaggccgtcggggacgtcatggccttgtctgtgtcc
acccccaaacacctgcacagcatcaacctgctggagcaagtcacggaaaaccaagaaagt
gacattaactacctgatgagcatcgccctggacaaaatcgccttcctgcccttcgggtac
ctcatggaccagtggcgctggaaggtgtttgatggccggatcaaggaggatgagtacaac
aaggagtggtggaacctgaggatgaagtaccagggcttgtgcccaccagcactgaggtct
gaagatgactttgatcctggggcaaagttccacatccctgccaacgtcccttacattagg
tactttgtcagcttcgtgatccagttccagttccaccaggcactctgtgatgcagctggg
cacaagggtcccctgcacacctgtgacatctaccagtccaaggaggccgggaagatcttg
ggggatgccctgaagctgggtttcagcaagccatggcccgaagccatgcagctcatcaca
ggccagcccaacatgtcagcagaggccctgatgagctactttgagcctctcatgacgtgg
ctggagaaagagaacagcaagaacggggaggtgctgggctggcccgagtacagctggact
ccttacgcagcccaagatgactccagcagaaccgatttcctgggaatgtccctgaccaaa
agtcaagccacagcaggtggctgggtcctgctggccctggcactcatcttcctgatcacc
accatcttcctgggcgtcaaattcttctcagccaggagaaaggccttcaaatccagctca
gaaatggaactgaaataa

DBGET integrated database retrieval system