KEGG   Ficedula albicollis (collared flycatcher): 101819841Help
Entry
101819841         CDS       T02815                                 

Definition
(RefSeq) protein-glutamine gamma-glutamyltransferase E-like
  KO
K05620  transglutaminase 3 [EC:2.3.2.13]
Organism
fab  Ficedula albicollis (collared flycatcher)
Brite
KEGG Orthology (KO) [BR:fab00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    101819841
Enzymes [BR:fab01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     101819841
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_C Transglut_N Transglut_core DUF2393 A2M_N DUF916 Poxvirus_B22R
Motif
Other DBs
NCBI-GeneID: 101819841
NCBI-ProteinID: XP_016158666
LinkDB All DBs
Position
20
AA seq 689 aa AA seqDB search
MGQAATQPSTNWHLKENAREHRTSKFSSEELIVRRGQAFTITFNGTERPEQNLIFIAETG
PKPSKATKTLATFDISSTVSKEGWSAVLQSSSSSSVSISISSPQNAVIGRYRLSVQSGTS
SPASLGTFVLLFNPWSSGDDVFMPNNAECEEYVLEEFGIIFAGNKNHINSFGWNFGQFQG
DILSICLSILDRSLYYRQDPVTDVSHRHDPRYLGRVLSAMVNANDDQGVVLGNWSGKYEG
GKNPTSWTGSGEILQSWKKSGFKPVKYGQCWVFAAVLTTVLRCLGIPTRTITNFSSAHDA
DGNLRVDEYYDADGNHLERGADSVWNFHVWNESWFTRNDLGSSYSGWQILDATPQEESGG
IYQCGPASRHAIKEGEVDLDYDGPFVFAEVNADCMYWNYDSATGKKTLIFSKSTEIGYSI
STKAVGRDDRVDVTRDYKYEEGSAKERDIFKKARKKLGLEDKFDPTAPKLEEIEQKPDIS
GKFKVAGSLEVGKDLNLLLVLENLQSDAKTVNVNMTAWSTLYTRRRVNQIWKDSISVTLA
PKEEKQFPIKIKYPEYQQQLTTDKTIQVTALCHVEDGIQVLVKRNITLDNPGIDIQVLGE
AKVNKEVVVEVAFTNPIDTEVKDCTLQVEGSDLLQGVLELSIPPLKASEKSSTKFKLIPS
EAGPKHLLVNFSCDKFPDIKTFKMVNVIN
NT seq 2070 nt NT seq  +upstreamnt  +downstreamnt
atgggccaagctgcaacgcagccaagtaccaactggcatctgaaagaaaatgcaagagaa
caccgcacaagcaaattttctagtgaagaactgattgtgaggagaggacaggccttcact
atcaccttcaatggaacagaacggcctgagcaaaacttaatattcattgcagaaacaggt
ccaaaaccctcaaaggcaaccaagaccctggccacgtttgatatctccagcacagtgagc
aaggagggctggagtgcagttctgcagtccagcagttccagctctgtgagcatctccatt
tccagcccacagaacgctgtcattggacgctacaggctgagtgttcaaagtggcacctcc
tctccagcaagtcttggcacttttgttttgctttttaacccttggtcttcaggtgatgat
gtgttcatgcctaacaatgctgagtgtgaggaatatgtgctagaagagtttggcatcatt
tttgcaggcaataaaaaccatatcaacagctttggatggaactttggccagtttcaggga
gacatcctcagtatttgcctgtccatcctggacagaagcttgtactaccgccaggatcct
gtcacggacgtgtctcaccgacacgaccccaggtacctgggccgtgtcctcagtgccatg
gtcaacgccaatgatgaccaaggggtggtgctaggaaactggagtggaaaatacgagggt
ggtaaaaatcccaccagctggacaggaagtggtgaaatcctgcaaagctggaagaaatca
ggattcaaacctgtaaaatatggacagtgttgggtttttgcagcagtattgactacagtg
cttagatgcctggggattcccacccgtacaattacaaacttcagttctgcccatgatgca
gatggaaatctccgtgtggatgagtattatgatgcagatggaaatcatttggagagggga
gctgacagtgtgtggaatttccatgtctggaatgaaagctggtttacacgaaatgacttg
ggctcctcatacagtgggtggcaaattctggatgcaactccccaagaagaaagtggagga
atttatcagtgtggtccagcctcacggcacgccatcaaagaaggagaagttgatctggac
tacgatggcccattcgtgtttgcagaagtgaatgcagactgtatgtactggaattatgac
tctgcaactggaaagaaaactttgatattctctaagtctacagaaattggttactccatc
agtacaaaggctgttggtagagatgatcgtgtagatgtcaccagggattataaatatgag
gaaggctctgcaaaagaaagagatatttttaaaaaagcccgtaagaagctgggacttgag
gataaatttgatcctacagcaccaaaactagaggaaattgaacaaaagcctgacatctca
ggaaaattcaaggtggctggctctttagaagttggcaaagatctcaacctacttctggtt
cttgaaaatttgcaatctgatgctaagactgtaaatgtaaatatgactgcatggagcact
ctgtatactagaagacgagttaaccagatctggaaggactccatatctgtcactctggcc
ccaaaggaagaaaaacaatttcccattaagataaagtatcctgaataccagcagcagtta
actacagacaaaacaatccaggtcacagctttatgtcatgtagaagatgggatccaagtg
cttgtgaaaagaaacatcaccctggacaatcctggcatcgacatacaggttcttggtgaa
gcaaaagtgaataaagaggtggttgtggaagtggcatttaccaaccctatcgacacggag
gtgaaggactgcacgctgcaggtggagggcagtgacctgctccaaggagtcctggagtta
agcataccaccactgaaagccagtgagaagtccagtaccaagtttaaacttatcccttct
gaggcgggtcccaaacatctacttgttaatttctcctgtgataaatttccagatatcaaa
acctttaagatggtaaatgtgattaactaa

DBGET integrated database retrieval system