KEGG   Ficedula albicollis (collared flycatcher): 101820125Help
Entry
101820125         CDS       T02815                                 

Gene name
YES1
Definition
(RefSeq) YES proto-oncogene 1, Src family tyrosine kinase
  KO
K05705  tyrosine-protein kinase Yes [EC:2.7.10.2]
Organism
fab  Ficedula albicollis (collared flycatcher)
Pathway
fab04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:fab00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    101820125 (YES1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fab01001]
    101820125 (YES1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fab04131]
    101820125 (YES1)
Enzymes [BR:fab01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     101820125 (YES1)
Protein kinases [BR:fab01001]
 Non-receptor tyrosine kinases
  SRC family
   101820125 (YES1)
Membrane trafficking [BR:fab04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    101820125 (YES1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase SH2 SH3_1 SH3_9 SH3_2 Haspin_kinase SH3_10 SH3_3 zf-RING_14 YdjC hSH3
Motif
Other DBs
NCBI-GeneID: 101820125
NCBI-ProteinID: XP_005041998
UniProt: U3JUR6
LinkDB All DBs
Position
2
AA seq 541 aa AA seqDB search
MGCIKSKEGKGPAMKYRTENAPEPVISHVSHYGSDSSQATQSPSIKGSAVNFNSHSMTPF
GGPSGMTPFGGASSSFSAVPSTYPSTLTGGVTVFVALYDYEARTTDDLSFKKGERFQIIN
NTEGDWWEARSIATGKTGYIPSNYVAPADSIQAEEWYFGKMGRKDAERLLLNPGNQRGIF
LVRESETTKGAYSLSIRDWDEVRGDNVKHYKIRKLDNGGYYITTRAQFESLQKLVKHYRE
HADGLCHKLTTVCPTVKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTKV
AIKTLKPGTMMPEAFLQEAQIMKKLRHDKLVPLYAVVSEEPIYIVTEFMTKGSLLDFLKE
GEGKYLKLPQLVDMAAQIADGMAYIERMNYIHRDLRAANILVGDNLVCKIADFGLARLIE
DNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELVTKGRVPYPGMVNREVL
EQVERGYRMPCPQGCPESLHELMKLCWKKDPDERPTFEYIQSFLEDYFTATEPQYQPGDN
L
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atggggtgtattaaaagcaaagaaggcaaaggcccagccatgaaatacagaactgaaaat
gctccagaacctgttatttcccatgtcagtcattatggatctgattccagccaagcaaca
cagtcaccgtcaataaagggatcagcagttaactttaatagtcattccatgactcctttt
ggaggcccttcaggaatgacaccctttggaggagcatcatcttcattttcagctgtgcca
agtacatatcctagtactttaacaggtggtgttactgtatttgtggccttatatgattat
gaagctagaactacagatgacctttcatttaagaaaggtgaacggttccagataataaat
aacacggaaggagactggtgggaagcaagatccattgctacgggaaagacaggctacatc
ccaagcaattacgtagctcctgcagactccattcaagcagaagagtggtattttggtaag
atgggcaggaaggatgcagaaaggctacttttaaatcctgggaaccagcgtggtattttc
ttagtaagagagagtgaaaccactaaaggtgcttattccctttctatacgtgactgggat
gaggtcagaggtgataatgtaaaacactacaaaatcaggaaacttgacaatggtggatac
tatatcacaaccagagcacaatttgaatctctacagaagttggtgaaacactacagagaa
catgccgatgggctgtgtcataagctaacaactgtttgtcccactgtgaaaccacaaacg
cagggactagcaaaagatgcctgggaaattcctagagaatctttgaggctggaagttaag
ttgggccaaggatgttttggtgaagtatggatgggaacatggaatggaaccacgaaagta
gcaatcaagacactaaaacctggtacaatgatgccagaagctttcctgcaggaggctcag
atcatgaagaaactacgacacgacaagcttgttccgctgtacgcagtcgtttctgaggaa
cccatctacatcgtcacggaattcatgacaaaaggcagcttgctagacttccttaaagaa
ggggaagggaaatacttaaaactcccacagctggtcgacatggctgctcagattgcggat
ggcatggcttacattgaaagaatgaactacatccacagggacctccgggcagctaacatt
cttgtaggagacaatcttgtgtgtaaaatagcagattttggtttagcaaggttaatagag
gacaatgagtacactgcaagacaaggagctaagtttccaattaaatggaccgctccagaa
gcagccttgtatggtcggtttacaatcaagtcggatgtgtggtcatttggaattttactg
acagagctggtaactaaggggagagtgccatatccaggaatggtgaaccgagaagttctg
gagcaagtggaacgtgggtataggatgccttgtccacaaggctgcccagagtctctccac
gagctaatgaaactgtgctggaagaaggaccctgatgagaggccaacatttgagtatata
cagtctttcttggaggactactttactgctacagaaccacagtaccagcctggagacaat
ttataa

DBGET integrated database retrieval system