KEGG   Ficedula albicollis (collared flycatcher): 101820159
Entry
101820159         CDS       T02815                                 

Gene name
RASSF1
Definition
(RefSeq) Ras association domain family member 1
  KO
K09850  Ras association domain-containing protein 1
Organism
fab  Ficedula albicollis (collared flycatcher)
SSDB
Motif
Pfam: Nore1-SARAH RA Ras_bdg_2 DUF5111 Mst1_SARAH
Other DBs
NCBI-GeneID: 101820159
NCBI-ProteinID: XP_005052998
LinkDB
Position
12
AA seq 263 aa
SLSPDCSFTCHYRCRALVRLDCSGPLGAGDEDDGNKQVLEKDTNVDEPSEWEKTELDQAQ
VEQRIKEYNSQINSNLFMSLNKDGSYTGFIKVQLKLVRPVSVPATKRVPSLQAGRSHPQG
VKRRTSFYLPKGTVKHLHILSHTRASEVIDALLRKFTVIDNPRKFALFERSEKDEQVYLR
KLGDDEQPLRLRLLAGPSEKVLSFILKENETGEVNWDAFTLPELQNFLLILQREEEEHVR
RLRHRYARCRQKMQEALATRTPG
NT seq 792 nt   +upstreamnt  +downstreamnt
tctctgtccccagactgcagcttcacctgccactaccggtgccgagccctggtgcggctg
gactgcagtggccccctgggtgctggtgatgaggacgatggcaacaagcaggtgttggag
aaggacaccaacgtggatgagcccagcgagtgggagaagacagagctggaccaggcgcag
gtggagcagcggatcaaggagtacaacagccagatcaacagcaacctgttcatgagcttg
aacaaggacggctcctacaccgggttcatcaaggtgcagctgaagctggttcgccctgtc
tcggtgccggccaccaagcgggtcccctccctgcaggcggggcggtcacacccccagggg
gtgaagcgccgaacgtccttctacctgcccaaagggaccgtcaagcacctgcacatcctc
tcgcacacccgcgccagcgaggtcatcgacgccctcctccgcaagttcaccgtcatcgac
aacccccgcaagttcgccctcttcgagaggtctgagaaggatgaacaagtgtacctacgg
aagctgggtgatgacgagcagccgctgcggctgcggctgctggccggccctagcgagaag
gtgctgagcttcatcctgaaggagaacgagaccggggaggtgaactgggacgccttcacg
ctgccggagctgcagaacttcctgctgatcctgcagcgggaggaggaggagcacgtgcgg
cggctgcggcaccgctacgcgcgctgccgccagaagatgcaggaggcgctggccacgcgc
acgcctgggtga

DBGET integrated database retrieval system