KEGG   Ficedula albicollis (collared flycatcher): 101820296Help
Entry
101820296         CDS       T02815                                 

Definition
(RefSeq) lysosomal alpha-glucosidase-like
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
fab  Ficedula albicollis (collared flycatcher)
Pathway
fab00052  Galactose metabolism
fab00500  Starch and sucrose metabolism
fab01100  Metabolic pathways
fab04142  Lysosome
Brite
KEGG Orthology (KO) [BR:fab00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    101820296
   00500 Starch and sucrose metabolism
    101820296
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    101820296
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fab04147]
    101820296
Enzymes [BR:fab01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     101820296
Exosome [BR:fab04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101820296
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 101820296
NCBI-ProteinID: XP_005054514
LinkDB All DBs
Position
14
AA seq 925 aa AA seqDB search
MKSYQKLRTAHAAARLEEEGAAPLPSGRGRLAPCWVGSGLLVAAVLLSTVTVWVLRQVSG
GWLGPTPPPKCLLVPESQRFDCYPERRVVVTQELCESRGCCFIQSPPLAEGKQGVPWCFY
PPDFPSYALESLNQTALGMVGVLVRREKAYYPRDIEKLRLDVEFETDTRLHIKITDAANP
RYEVPLDVPRVTKRAENPIYSLNFSWDPFGVLLQRKATGAVLLNTTVAPLIFADQFLQIS
TSLPSKFLYGLGEHRDSFLHSLDWNTLTFWARDVAPTESFNLYGAHPFYLLMEEGGNAHG
VFLLNSNAMEVALQPAPGLTWRTIGGVLDFYIFLGPDPNMVIQQYQQVIGFPAMPPIWAL
GFHLCRWGYGSSNETWQTVRAMRNYQIPQDAQWNDIDYMDGYRDFTLDSQKFTSLPSLVE
DLHKHGQRYVMILDAGISSTSPHGSYWPFDEGLRRGLFLNTTKGQPLIGQVWPGFTAFPD
FSNPDTHQWWLENLQHFYAHVPFDGVWIDMNEPSNFMDGSEDGCPPGELDSPPYTPAVLG
DSLSAKTVCASAEQKASVHYNLHNLYGLMEAKATASALVRIRGKRPFLVSRSTFPSQGRY
SGHWLGDNRSQWKDMYYSIPGLLSFSLFGIPLVGADICGFSGSTSEELCTRWMQLGAFYP
FSRNHNTQNEQAQDPTAFSPAARTAMKDVLLTRYSLLPFLYTLFHRAHLQGDTVARPLFF
EFPRDVATWELDRQFLWGQSLLVTPVLEPGVDSVTGYIPQGTWYDFYTGSSLNSSGEMLK
MSAPLEHLNLHVRGGSILPTQKPGTTTGVTRGNPLRLIVALSSHATAWGDLFWDDGESLD
TFEKGNYSYVVFNVTQNTFTSTVLHTSTEATKVTIGTLSIFGVQKPPSKVLLNGQEKPFS
YLDNQVLTVSDLGMSLSQGFSLQWL
NT seq 2778 nt NT seq  +upstreamnt  +downstreamnt
atgaagtcgtaccagaagctgaggacagcacatgcagcagcacgcctggaggaggagggc
gctgccccgctgccctccggccgggggaggctggccccgtgctgggtgggcagcgggctg
ctggtggccgctgtgctgctgagcaccgtcactgtctgggtgctgcgccaggtgtcgggg
ggctggctcgggcccacgccgccccccaaatgtctcctggtgcctgagagccagcgcttc
gactgctacccggagcggcgcgtggtggtgacacaggagctctgtgaaagccgagggtgc
tgcttcatccagagtcccccgctggcagagggcaagcagggggtgccctggtgcttctat
ccccctgacttccccagctacgccctggagagcctcaaccagacagcgctgggcatggtg
ggggtgctggtgcggagggagaaggcctactacccccgggacatcgagaagctgaggctg
gatgtggagtttgagacagacacacggctgcacatcaagataacagatgcagccaaccca
cgctatgaagttccccttgatgttccccgggtgacaaagagagcagaaaaccccatctac
agtctgaacttctcctgggacccctttggggtgctgctgcagcgcaaggcaaccggggca
gtgctgctaaacaccaccgtggcccccttgatctttgctgaccagtttctccagatatcc
acatcactcccatccaagttcctctatggtctgggggagcaccgtgacagcttcctgcac
agcctggactggaacacgctcacattctgggcccgtgacgtcgctcccacggaatcgttc
aacctgtacggtgcccacccgttctacctgctgatggaggagggtggaaatgctcatggt
gttttcctactcaacagcaacgccatggaggtggctctgcagcctgctccaggcctgacc
tggaggaccattggaggggtgctggatttttacatcttcctggggcccgatcccaacatg
gtcatccagcagtaccagcaggtgataggtttcccagccatgccccccatctgggctctt
ggcttccacctctgccgctggggctacggatccagcaatgagacgtggcagactgtgaga
gccatgaggaactaccagatcccccaggatgcacagtggaatgacatcgattacatggat
ggctaccgggacttcaccttggattcccagaagttcacctccctcccctccctggtggaa
gacctccacaagcacgggcagcgctacgttatgatcttggatgctggcatcagcagcacc
agccctcacggctcctactggccttttgatgaaggcttgagacgaggcttgttcctcaac
accaccaaagggcagccactcatcgggcaggtctggcctggtttcactgccttcccagac
ttctccaacccagacacacaccagtggtggctggagaacctgcagcacttctatgcccac
gtgcccttcgacggtgtctggattgacatgaatgagccctccaacttcatggatgggtct
gaagatggctgtcccccaggagagctcgacagccccccctacactccagctgtgctgggt
gattccctctctgcaaagacggtgtgtgcctcggcagagcagaaagcctcagtgcactac
aacctccacaacctctatgggctgatggaagccaaagccacagcaagcgccttggtcagg
atccgggggaagcgccccttcctcgtctcccgctccaccttccccagccagggccgctac
tcggggcactggctgggcgacaaccgcagccagtggaaggacatgtactactcaattcca
gggctgctgagcttcagcctctttggcatcccactggtcggagcggacatctgcggcttc
tccggcagcacctcggaggagctgtgcacccgctggatgcagctcggcgccttctacccc
ttctctcgcaaccacaacacccagaacgagcaggcccaggaccccacagcgttcagccct
gcagccaggacagccatgaaggacgtgctgctgacccgctattccctcctgcccttcctc
tacacgcttttccaccgtgcccacctgcaaggggacaccgtggcccggcccttgttcttt
gagttccctcgggatgtggccacatgggagctggacaggcagttcctgtggggccagagc
ctgctggtgacaccagtgctggagcctggggtggactcagtcacaggttacatcccccaa
ggcacgtggtacgacttctacacgggctcctcgctgaacagcagcggggagatgttgaag
atgtcggcccctctggagcacctcaacctgcacgtccggggaggttccatcctgcccacc
cagaaaccaggaaccaccacaggggtgacccgagggaaccccctgcgtctcattgtggcc
ttgtcctcgcatgccactgcctggggtgaccttttctgggatgatggcgagagcctggac
acctttgagaagggcaactactcctacgtggtgttcaatgtcacacagaacaccttcacc
tccaccgtccttcacaccagcactgaggccaccaaggtcaccattggcacactgagcatc
tttggggtgcagaagccgcccagcaaggtcctcctgaatggccaggagaagcctttttcc
tacctggacaaccaggttctcaccgtgagtgaccttggcatgagcctcagccagggcttc
tccctgcagtggctgtga

DBGET integrated database retrieval system