KEGG   Ficedula albicollis (collared flycatcher): 101820423Help
Entry
101820423         CDS       T02815                                 

Gene name
ULK3
Definition
(RefSeq) unc-51 like kinase 3
  KO
K21358  serine/threonine-protein kinase ULK3 [EC:2.7.11.1]
Organism
fab  Ficedula albicollis (collared flycatcher)
Brite
KEGG Orthology (KO) [BR:fab00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fab01001]
    101820423 (ULK3)
Enzymes [BR:fab01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101820423 (ULK3)
Protein kinases [BR:fab01001]
 Serine/threonine kinases: Other
  ULK family [OT]
   101820423 (ULK3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr MIT Kdo Choline_kinase APH CCDC92
Motif
Other DBs
NCBI-GeneID: 101820423
NCBI-ProteinID: XP_016156390
LinkDB All DBs
Position
10
AA seq 460 aa AA seqDB search
SLPFPSLPSRRALWVKGSSLVPPPRQRDTREVVAIKCVNKRSLNRASVENLLTEIEILKT
IRHPNIVELKDFQWDGDHIYLIMEFCAGGDLSRFIRTRRALPETVARVFLQQLACALKFL
HDRNISHLDLKPQNILLSAPESPQLKLADFGFAQYMSPWDEKHVLRGSPLYMAPEMVCRQ
HYDARADLWSVGVILYEALFGKPPFASRSFAELEEKIRSDRAVELPSWPQLSLECRDLLA
QLLERDPRKRISFECFFAHPFVDMEHIPGPESLGKATDLVVEAVRKDQEGDAKAAFSLYR
KALEYFVPALHYESDARRKEAIRAKVRQYISRAEELKVLVTSSNKNLLEKGNPARELLKE
MAKDKPRLCAALEVASAAIAKEEEGRDDSDALELYQQSLGELLLLLAAEPAGRRRELLHA
EIQTLMARAEYLKDQIKMREAQSMGKEALAESVRSACTLQ
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
tcccttcccttcccttcccttccctcccggcgggctctttgggtgaagggatccagcctt
gtcccccctcctcggcagagggacacgcgtgaggtggtggccatcaaatgtgtcaacaag
aggagcctgaaccgggcatcggtggagaatctgctgacagagatcgagatcctcaagacc
atccgccatcccaacattgtggagctcaaggacttccagtgggacggtgaccacatctac
ctgatcatggagttctgcgccgggggggacctgtcccgcttcatccgcacgcgccgcgcg
ctccccgagacggtggcgcgcgtcttcctgcagcagctcgcctgcgccctgaagttcctc
cacgaccgcaacatctcccacctggacctgaagccgcagaacatcctcctgagcgccccg
gagagcccccagctgaagctggcagatttcggctttgctcagtacatgtccccgtgggac
gagaagcacgtgctgcgtggctccccgctctacatggcccccgagatggtgtgtcggcag
cactacgacgcccgcgccgacctgtggtcggtgggcgtcatcctttacgaagcacttttt
gggaagccgcccttcgcttcccgctccttcgccgagctggaggagaagatccgcagcgac
cgggctgtggagcttcccagctggccccagctctctctggaatgccgggatctcttggca
cagctgctggagagggaccctcggaagcgcatctccttcgagtgcttcttcgcccacccc
tttgtggacatggagcacatccccggccccgagagcctgggcaaggcgaccgacctggtg
gtggaggcggtgaggaaggaccaggagggagacgccaaagctgccttctccctctaccgc
aaagccctggagtatttcgtgccagcactgcactatgaaagcgacgcgcggcgcaaagaa
gccatccgggccaaggtgaggcagtacatctcccgagcagaggagctgaaggtgctggtc
acctccagcaacaagaacctcctggagaaaggaaacccggccagagagctccttaaagag
atggccaaggacaagcctcggctctgcgccgcgctggaagtggcttcagctgccatcgcc
aaggaggaggaaggcagggatgacagtgacgccctggagctgtaccagcagagcttgggg
gagctgctgctgctcctggccgcggagccggcggggcggcggcgggagctgctccacgcc
gagatccagaccctgatggcccgagccgagtacctgaaggatcagatcaagatgcgggag
gcacaatccatgggcaaagaggcgctggcagagtccgtccggagcgcctgtaccttgcag
tga

DBGET integrated database retrieval system