KEGG   Ficedula albicollis (collared flycatcher): 101820732Help
Entry
101820732         CDS       T02815                                 

Gene name
CNIH4
Definition
(RefSeq) cornichon family AMPA receptor auxiliary protein 4
  KO
K20368  protein cornichon
Organism
fab  Ficedula albicollis (collared flycatcher)
Brite
KEGG Orthology (KO) [BR:fab00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fab04131]
    101820732 (CNIH4)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:fab02000]
    101820732 (CNIH4)
Membrane trafficking [BR:fab04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   ER-Golgi intermediate compartment (ERGIC) proteins
    101820732 (CNIH4)
Transporters [BR:fab02000]
 Other transporters
  Accessory factors involved in transport [TC:8]
   101820732 (CNIH4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cornichon
Motif
Other DBs
NCBI-GeneID: 101820732
NCBI-ProteinID: XP_005043248
LinkDB All DBs
Position
3
AA seq 159 aa AA seqDB search
MGLRAPRHAGSPCAFRVFPSLLAKRKALCILNYHAVFPYPELQIITLSDLECDYINARSC
CSKLNKWVVPEVIGHAVVTVLMLISLHWFIFLLNLPVATWNIYRYIMVPSGNMGVFDPTE
IHNRGQLKSHMKEAMIKLGFHLLCFFMYLYSMILALIND
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgggactccgggctccgcggcacgcaggatcgccgtgcgcttttagggttttccccagt
ttattggctaaaaggaaagctttgtgtattctgaattaccacgcagtgtttccttatcct
gaacttcagataatcacactatcagatctggaatgtgactacatcaacgctagatcgtgc
tgctccaagctcaataaatgggtggtgcctgaggtgattggccatgctgttgtcacggta
ttaatgcttatttcattgcactggttcatctttctcctgaacctgccagtggccacatgg
aatatatataggtacattatggtgccaagtggaaacatgggagtatttgatcccacagag
atccataaccgaggacaactgaaatcacacatgaaagaagccatgattaagctgggcttt
catctgctctgtttcttcatgtacctttacagtatgattctggctttgataaatgattga

DBGET integrated database retrieval system