KEGG   Ficedula albicollis (collared flycatcher): 101820872Help
Entry
101820872         CDS       T02815                                 

Gene name
GANC
Definition
(RefSeq) glucosidase alpha, neutral C
  KO
K12317  neutral alpha-glucosidase C [EC:3.2.1.20]
Organism
fab  Ficedula albicollis (collared flycatcher)
Pathway
fab00052  Galactose metabolism
fab00500  Starch and sucrose metabolism
fab01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fab00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    101820872 (GANC)
   00500 Starch and sucrose metabolism
    101820872 (GANC)
Enzymes [BR:fab01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     101820872 (GANC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 Gal_mutarotas_2 NtCtMGAM_N DUF5110 POC3_POC4
Motif
Other DBs
NCBI-GeneID: 101820872
NCBI-ProteinID: XP_016154403
LinkDB All DBs
Position
5
AA seq 992 aa AA seqDB search
MCMLLSLPDKARFEAQQLSSTQIQGFIRSAEIPPPSPRPVCTSLGPAQHGPALPRPGQGS
LPSPRCAHRGRAPPGDLPSFAPSRGPHTGGSPSAASGLFPAQACSPLPPRPTRQRGLKPG
SRAGDSHGPEPPHQLASGSTEARPGQGRPRPQPSALSSVQDEAVDKSNFKKCNQIAFYRR
QKLLHPGKSLYRVLLDSVTLSDESVKFQIIHEKNKILLQVEIYEIEGNIFRLKIDEASPL
RPRYKVPDVLIKEPTTQRLFISHREAGILVLSSVNEDYKLQITANPFQVELQSKGETVMS
MNSNGLLYFEHLQSPPSDRKPTAQNEEAASDSSKEKQEDLGLWQEKFGSFLDIKAHGPTS
VGVDFSLHGYDHVYGIPQRTETLLLKNTSDGDAYRLYNLDIFGHKIHDKIGIYGSVPLLL
AHKPSRTSGIFWLNSSETLVDISTKAVAEHTPSRSAAEIAKQRAVPLTDVRWMSESGIID
VFLLMGPTAFDIFKQFAQLTGTQALPPLFSLGYHQCRWNYEDEQDVKAVDAGFDAHDIPY
DVIWLDIEHTDGKRYFTWDKQKFQNPRKMQEHLKKKKRKLVVIVDPHIKVDPSYTLYAQA
KEKGYFVKDRNGKDFEGICWPGSSCYLDFTNPEVRKWYADQFAFKTYKASTNILFVWNDM
NEPSVFKEAELTMQKDAVHYNNWEHREVHNLYGFYQQMATAEGLIRRSSGKERPFVLARS
FFAGSQKYGAVWTGDNTAEWSYLQISIPMLLTINMTGISFCGADVGGFIGDPEPELLVRW
YQAGAYQPFFRGHSNMESKRREPWLFGEKNTQLIRRAIRERYVLLPYLYTLFYRAHAAAE
PVMRALWIEFPGEVETFDVENEYMLGNALLVHPVTEKEAKTVTVLFPGSEEIWYDFRKFK
RMEDAGTVKIPVTLENIPVFQRGGTVIPLKTTAGKSTEWMIDISYELHVALDKEACAIGE
LYVDDGHSFQYLHKKQFLYRKFTFHKNVLSSR
NT seq 2979 nt NT seq  +upstreamnt  +downstreamnt
atgtgcatgttactctcactgcctgataaagcccgatttgaggcacagcagctttcctcc
actcaaatccaagggtttatcagaagtgccgaaatccctccaccttccccaaggcccgtg
tgcacctctctcggtccggcgcagcacggcccggctctcccgaggcccggccagggcagc
cttccctccccgcgctgcgcccaccggggccgggcaccgccgggggaccttccctccttc
gctccctcccgcgggcctcacacgggcggctctccctccgccgcctccggactatttccc
gcacaagcctgctctcccttaccgccacggccgacccgccagagagggctcaagcccggc
agcagggcaggagacagccacggccccgagcccccgcaccagctcgcgtcaggctccaca
gaggcgcggcccgggcagggacgcccccgaccgcagccatctgctctttctagtgtccaa
gatgaggctgtggacaaaagcaacttcaagaaatgcaaccagattgctttttacaggcgt
cagaaacttctacatcctggaaagtccttgtatcgagtgttgttggattcagtcacatta
agtgatgagagtgtcaaattccaaatcattcatgaaaagaataagattcttctacaagtt
gaaatttatgaaatagaaggcaatattttcaggcttaaaattgatgaggcatctcctctc
agaccaagatacaaagttcctgatgttcttataaaggaacctaccacccagagactgttc
atatcccacagggaggcaggtattttggtattgtcaagtgttaatgaggactacaaactt
caaatcacagcaaaccccttccaagttgagctgcagtccaagggtgagactgttatgagc
atgaattccaatgggttgttgtattttgagcacctacaatcacctcccagtgacagaaaa
cctacagcacaaaatgaggaggcagcaagcgattcctctaaggaaaaacaagaggatcta
ggtctctggcaagagaaatttggcagtttcttagacatcaaagctcatggtcctacttct
gtaggtgtggacttctctttacatggatatgaccatgtttatggaataccacaacgcaca
gaaacacttcttctcaaaaacaccagtgatggtgatgcctaccggctctataatttggat
attttcggccacaagatacatgacaaaataggcatttatggttcagtaccccttctctta
gcacacaagcctagcagaacttcagggatcttctggctgaattcttcagaaacactggtg
gatattagtacaaaggcagtagctgagcacactccatccagatctgctgcagagattgct
aagcagagagctgtgcctctgactgacgtacgctggatgtcagaaagtgggatcattgat
gttttcctactgatgggacccactgcatttgatatcttcaagcagtttgcacagctgaca
ggcactcaagccttgcccccacttttttctctgggctaccatcagtgcaggtggaattat
gaagatgagcaagatgtcaaggcagtggatgctggctttgatgcacatgacattccttat
gatgtcatatggctggatatagagcacacagatggcaagaggtattttacctgggacaaa
cagaaattccagaaccccagaaagatgcaagagcatctcaagaagaaaaaacgcaagctt
gtggtcatcgtagatcctcatattaaggttgatccctcgtataccctgtatgcacaggca
aaagaaaagggatattttgtgaaagacagaaatgggaaagattttgagggcatctgttgg
ccaggttcctcttgttacctggatttcaccaatcctgaagtgcgaaaatggtatgcagat
caatttgccttcaaaacatacaaggcatccactaatatcctctttgtatggaatgatatg
aatgagccttcagtcttcaaggaggcagaactaacaatgcagaaagatgctgtgcactac
aataactgggagcatcgggaagtgcacaacctctatggattctaccagcaaatggcaact
gcagaaggacttatcagacgttcttcaggaaaagagagaccatttgtccttgcacgatct
ttctttgctggatcacagaagtatggggcagtgtggactggagacaacacagcagagtgg
agttacttgcaaatatccattccaatgcttcttaccatcaacatgacagggatttcattc
tgtggagctgatgtgggagggtttattggagatccagaaccagagttacttgttcgctgg
tatcaggcaggagcctaccagcccttcttcagaggtcactctaacatggagagcaaacgg
cgcgaaccgtggctctttggggagaagaacacccagctcatcaggagagccattagagag
cgctacgtcctcctgccctacttatacactctgttctatcgggcacacgcggcggccgaa
cccgtcatgagggctctctggatagagtttccaggggaagtggaaacttttgatgtggaa
aatgagtacatgctgggaaatgctttgttggtgcatccagtcacagagaaagaggccaag
acagtgacagttctgtttccagggtcagaggagatttggtatgacttcagaaaatttaag
cgaatggaagatgcaggcacagtgaagatcccagtaacactggagaatattcctgtattc
cagcggggaggcactgtgataccactgaagaccacagctggaaaatccactgaatggatg
atagatatttcttatgagctccacgtggccttagacaaagaggcctgtgccataggtgag
ctctacgtagatgatggacattcatttcaatatctccacaagaaacagttcctgtatcgg
aaattcactttccacaagaatgttctctcttccaggtaa

DBGET integrated database retrieval system