KEGG   Ficedula albicollis (collared flycatcher): 101820996
Entry
101820996         CDS       T02815                                 

Gene name
PDGFRA
Definition
(RefSeq) platelet derived growth factor receptor alpha
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
fab  Ficedula albicollis (collared flycatcher)
Pathway
fab04010  MAPK signaling pathway
fab04020  Calcium signaling pathway
fab04144  Endocytosis
fab04510  Focal adhesion
fab04540  Gap junction
fab04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:fab00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101820996 (PDGFRA)
   04020 Calcium signaling pathway
    101820996 (PDGFRA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101820996 (PDGFRA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101820996 (PDGFRA)
   04540 Gap junction
    101820996 (PDGFRA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101820996 (PDGFRA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fab01001]
    101820996 (PDGFRA)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:fab04090]
    101820996 (PDGFRA)
Enzymes [BR:fab01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     101820996 (PDGFRA)
Protein kinases [BR:fab01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   101820996 (PDGFRA)
CD molecules [BR:fab04090]
 Proteins
  101820996 (PDGFRA)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 ig I-set Ig_2 V-set Herpes_gE Kinase-like Adeno_E3_CR1
Other DBs
NCBI-GeneID: 101820996
NCBI-ProteinID: XP_005045347
UniProt: U3JLD9
LinkDB
Position
4
AA seq 1087 aa
MGTSPWMFLILGCFLTGPFLTFCQLPLPTIVPNRNEMVVQLYSNFTLKCSGDSEVSWQYP
VTEGNHRIDIRHEENNSGLFVTVLEVGNASAAHTGLYVCYYNHTQVEDGEVEGKDIYIYV
PDPDMPFVPSIPEDQFILVEEGDPAVIPCRTSDPDAQVTLVNSLDKSVHALYDTKQGFIG
NFPAGSYTCKTMVKGVEFKSDEFLIYIIRATSQLPVEIEALKTVYKTGETIVVTCVVFDN
EVVNLQWNYPGKVKEKGLIKLDDIKVPSQKLVYTLTIPEASVKDTGDYECTARHATKEVK
ENKKVVITVHDKGFVHLEPQFSPLEAVNLHEVKNFVVDVQAYPAPKMYWLKDNVTLIENL
TEIVTTSGRVQETRFQSILKLIRAKEEDSGYYTLVAENEDEIKRYTFSLLIQVPALISAL
VDDHHGSAGGQTVRCLAEGTPLPDVEWLVCKDIKKCSNDTSWTLLTNNISDIHMEAHLDE
KNMVESQVTFQKVEETLAVRCVARNDLGAVTRELKLVAPTLRSELTVAAAVLVLLVIVII
SLIVLVIIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRILG
SGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGPHLNIVNL
LGACTKSGPIYIITEYCFYGDLVNYLHKNRDNFLNRHPEKPKKDLDIFGMNPADESTRSY
VILSFENTGEYMDMKQADTTQYVPMLERKEGSKYSDIQRSVYDRPASYKKKSLSESEVKN
LLSDDSSEGLSLLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAQGKIVKICDFGLA
RDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSLGGTPYPGMM
VDSTFYNKIKSGYRMAKPDHATNEVYEIMVKCWNSEPEKRPSFYHLSEIVESLLPGEYKK
SYEKIHLDFLKSDHPAVTRMRGDCDNAYIGVTYKNEDKLKDRESGFDEQRLSADSGYIIP
LPDIDPVSEDELGKRNRHSSQTSEESAIETGSSSSTFIKREDETIEDIDMMDDIGIDPSD
LVEDSFL
NT seq 3264 nt   +upstreamnt  +downstreamnt
atgggtacttccccatggatgttcctgattctgggatgttttctcacaggaccattccta
acattttgccagcttcctctgccaactattgttcccaataggaacgaaatggtggtccag
ctgtattccaatttcacactcaaatgctctggggacagcgaagtgagctggcagtaccca
gtgaccgagggaaaccacaggatagacattagacatgaggaaaacaacagtggcctcttc
gtgacagtgctcgaagtaggaaacgcctcggccgctcatacgggcttgtatgtttgctat
tacaaccacacacaggtggaggatggggaagtggaagggaaggacatctacatctatgtg
cctgatccagacatgccttttgttccttctataccagaagaccagttcatcctagtggaa
gaaggtgaccctgcagttatcccttgtcggacaagtgacccagacgctcaagtgacttta
gttaacagtttagacaagtctgtgcatgctttgtatgacaccaaacaaggcttcataggc
aattttcctgcgggctcatacacatgcaaaacaatggttaaaggcgtggagttcaagtcg
gatgagttcctcatctatattataagagctacttcacagctgcctgttgaaattgaagct
cttaaaaccgtctacaaaaccggcgagaccattgtagtgacttgtgtggtctttgacaat
gaggtggttaatttacagtggaattatcctggcaaagtgaaagaaaaaggtctgataaaa
cttgatgatatcaaagtcccatcacagaagctggtttacaccttgaccatccctgaggca
tcagtgaaagacacaggggattatgaatgcactgctcgccacgcaaccaaggaggttaag
gaaaataagaaagtagtcattacagttcatgacaaaggctttgttcacctggagcctcag
tttagccctctggaagctgtcaacctgcatgaagtcaaaaactttgttgtggatgtgcag
gcttacccagcaccaaaaatgtactggttgaaggataatgtgactctgattgaaaatctt
acagagattgttactacttcaggaagagtccaggaaacgaggtttcagagcattttaaaa
ttgatacgggccaaggaggaagacagtggatactacaccttggttgctgaaaatgaagat
gagattaaaagatacaccttctcattgctaatacaagtaccagctctgatctcagccctc
gtggatgatcaccatggctctgcaggcgggcagacagtgagatgcttggcagaggggacc
ccacttcctgatgtggaatggctggtttgcaaggacattaaaaagtgcagcaacgacacc
tcatggacccttttgactaacaatatctctgatatacacatggaagcccacctggatgag
aaaaacatggtggaaagccaggtgaccttccagaaggtagaggaaaccctggctgtgcga
tgtgtggcaaggaatgaccttggtgctgttactcgagagctgaagcttgtggctcccacc
ttgagatcagagctaacggtggctgctgctgtcctagtgctgctagtgattgtgataatc
tcactgattgtcctggtcatcatatggaaacagaagccaaggtatgagattagatggaga
gtcattgagtctatcagccccgatggccacgagtacatttatgtggacccaatgcaactg
ccttacgactccagatgggagtttcctcgagatgggttagtgcttggtcggatccttggt
tcaggtgcatttggaaaagtagttgaaggaactgcatatggattgagtcgctctcagcca
gtgatgaaagtggctgtgaaaatgctgaaacctacagctagatccagtgaaaaacaggca
ctcatgtctgaactgaagataatgacacatcttggcccccacctaaatattgtgaatctg
cttggagcttgtacaaaatcaggtcctatttacatcatcactgaatactgtttttatggt
gatttggtgaactacctgcataagaatagggataatttcctgaaccgacacccagaaaag
cctaaaaaagatttggatatctttgggatgaaccctgctgatgaaagcacaagaagttat
gtgatactatcatttgaaaacactggagaatacatggacatgaaacaagctgataccact
cagtatgtgccaatgctggaaaggaaggagggctctaaatactctgatattcagagatct
gtgtatgatcggccagcttcatataagaagaaatccctgtcagaatcagaagtcaaaaac
cttctttcagatgacagttcagagggcctcagcctactggatttgctgagcttcacctac
caggttgcaaggggaatggaattcttggcttctaaaaattgtgtgcaccgtgacttggct
gctcgtaatgtcctcctggctcaaggaaaaatcgtgaagatctgtgactttgggctggct
agggacatcatgcatgattccaactatgtctccaagggcagtactttcctcccagtaaaa
tggatggcacctgaaagtatttttgacaacctgtacacaacattgagtgatgtctggtct
tatggcattctgctgtgggaaatattttctcttggtggcacaccgtatcctggcatgatg
gtcgattctactttctacaataagatcaagagcggatatcgaatggccaaacctgaccat
gctaccaatgaagtgtatgagattatggtgaagtgctggaacagtgaaccagagaaaaga
ccttctttctaccatttgagtgaaattgtggagagcttgttgcctggagagtacaaaaag
agctatgagaagattcatctggacttcctgaaaagtgatcacccagctgtcacacgcatg
agaggggattgtgacaatgcttacattggtgtaacctacaagaacgaagacaagctaaag
gacagggagagtggatttgatgagcagaggcttagtgctgacagtggatacatcattccc
ctgcctgacattgaccctgtttctgaagatgagctcggcaaaagaaacagacacagttca
cagacatctgaagaaagtgccattgagactggttccagcagctctaccttcatcaagaga
gaggacgagaccattgaggacattgacatgatggacgacattgggatcgacccctcagac
ctggtggaggacagcttcctgtag

DBGET integrated database retrieval system