KEGG   Ficedula albicollis (collared flycatcher): 101821038
Entry
101821038         CDS       T02815                                 

Definition
(RefSeq) uncharacterized LOC101821038
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
fab  Ficedula albicollis (collared flycatcher)
Pathway
fab04010  MAPK signaling pathway
fab04210  Apoptosis
fab04620  Toll-like receptor signaling pathway
fab04621  NOD-like receptor signaling pathway
fab04622  RIG-I-like receptor signaling pathway
fab04623  Cytosolic DNA-sensing pathway
fab04625  C-type lectin receptor signaling pathway
fab04920  Adipocytokine signaling pathway
fab05132  Salmonella infection
fab05164  Influenza A
fab05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:fab00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101821038
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    101821038
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101821038
   04621 NOD-like receptor signaling pathway
    101821038
   04622 RIG-I-like receptor signaling pathway
    101821038
   04623 Cytosolic DNA-sensing pathway
    101821038
   04625 C-type lectin receptor signaling pathway
    101821038
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    101821038
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101821038
  09172 Infectious disease: viral
   05164 Influenza A
    101821038
   05168 Herpes simplex virus 1 infection
    101821038
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fab01001]
    101821038
Protein kinases [BR:fab01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   101821038
SSDB
Motif
Pfam: zf_C2H2_10 CC2-LZ TALPID3 Cortex-I_coil TPD52
Other DBs
NCBI-GeneID: 101821038
NCBI-ProteinID: XP_016160402
LinkDB
Position
LG34
AA seq 523 aa
MPSAPPVPPSSEDQLRQRLVEAEAELVALRARVAVAELRAQDVSRAAELQLQGLRRQLEQ
DKAQVQAQVTSLLGELRESQNRLERSRAEREHLERRARSDAERCQQLEEVTQGHQVQLDQ
LRLQVTNLETALRVERRGATEEKRKLVQLQAAYHHLFQEYDAHIKASLEGDKQSQVRDRD
TGAAGDTEGHVPSLGEPGVAPCSLCHSPGDPVVAAWPHPSPLETPGMSLGSSGQGYSGGD
TGDPQMSLSLPGDIMGTQVDVLNVGLGGSGRIKGDLGVPRGADTPRVDFKAEQGESWGGV
EVLERAQWDLGNLGDPGGVLTPPPPKIQTDISKAEAGESQADISKAVFEEERAALRGFWL
DLGDPDGTEMFLGDFGDPWWILRQSRWLWGIWGFWCDLWGFLWGIWGFPGGIWGSPVGSG
APDPPCGQADIYRADFEAERAAREQLHGQREALQEELNQLRLRLGGDGARYGTTPPNSLS
SPKPPGGVLLPPPEEGPDLCCPKCQYKAPDMDTLQIHVMDCIK
NT seq 1572 nt   +upstreamnt  +downstreamnt
atgccctccgcacccccagtgcccccaagctccgaggatcagctgaggcagcgcctggtg
gaggctgaggctgagctggtggcgctgcgggcgcgcgtggccgtggccgagctccgggct
caggatgtttcccgcgcggccgagctgcagctgcaggggctgcgccgccagctggagcag
gacaaggcacaggtgcaggcgcaggtgacgtcactgctgggggagctgcgtgagagccag
aaccggctggagcggagccgggcggagcgggagcacctggagcgcagggcccgcagtgat
gccgagcgctgccagcagctggaggaggtgacccagggccaccaggtgcagctggaccag
ctgcggctgcaggtgacaaacctggaaactgccctgagggtggagcggcgcggggccact
gaggagaagcggaagctggtgcagctgcaggccgcgtaccatcacctgttccaggagtac
gacgctcacatcaaggccagcctggagggggacaaacagagccaggtgagggacagggac
actggggcagctggggacacggagggtcatgtcccatcccttggggagcccggggtggcc
ccttgttctctgtgtcattctcctggggaccctgtggtggcagcttggccccatcctagc
cccttggagacacctggaatgtcccttgggagcagtggccaaggctactctgggggtgac
acaggtgacccccagatgtcattgtcactgccaggtgacatcatggggacccaggtcgat
gtcctcaatgtggggctggggggatctgggaggatcaagggggatttgggagttcccaga
ggggctgacacccccagagtggatttcaaggcagagcagggggagtcttgggggggtgtg
gaggttttggagagggcccagtgggatttggggaatttgggggatcctggaggtgtcctg
accccacctccccctaaaatccagactgacatctccaaggcagaggcaggggagtcccag
gctgacatttccaaggccgtttttgaggaggagcgggcagctctgagggggttctggttg
gatttgggggatcctgatgggactgaaatgttcctgggggattttggggatccctggtgg
attttgaggcagagcaggtggctctgggggatttgggggttctggtgtgacctgtggggg
ttcctttgggggatttgggggttccctggtgggatttggggttccccggtgggatctggg
gcgcctgaccccccgtgtggccaggccgacatttaccgagcggatttcgaggcggagcgc
gcggcgcgggagcagctgcacgggcagcgggaggcgctgcaggaggagctgaaccagctg
cggctgcggctgggcggggacggggcccggtatggcactacccccccaaattccctcagc
tcccccaaacccccgggtggggtgctcctgccgccccccgaagaggggcccgacctgtgc
tgccccaagtgccagtacaaggctccggacatggacacgctgcagatccacgtcatggac
tgcatcaagtga

DBGET integrated database retrieval system