KEGG   Ficedula albicollis (collared flycatcher): 101822017Help
Entry
101822017         CDS       T02815                                 

Gene name
POLRMT
Definition
(RefSeq) RNA polymerase mitochondrial
  KO
K10908  DNA-directed RNA polymerase, mitochondrial [EC:2.7.7.6]
Organism
fab  Ficedula albicollis (collared flycatcher)
Brite
KEGG Orthology (KO) [BR:fab00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:fab03029]
    101822017 (POLRMT)
Enzymes [BR:fab01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.6  DNA-directed RNA polymerase
     101822017 (POLRMT)
Mitochondrial biogenesis [BR:fab03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial RNA polymerase
    101822017 (POLRMT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RNA_pol RPOL_N PPR_2 PPR_3
Motif
Other DBs
NCBI-GeneID: 101822017
NCBI-ProteinID: XP_005060140
LinkDB All DBs
Position
28
AA seq 1215 aa AA seqDB search
MSLLRLRAVLRGPGGLRGPGIAWRIFRSYSSASTKEKANRNGICERTELLEVLKARAKQL
QGSNVPQVTVSKVELDAVDNDKYQEAVDPGPKEKQPRARGDGLARSSSWATKLQKEMYIQ
QLKMKQELPSAASQLALEGQAKLDVKAEAKAKAKTMKSPKISWNQSSGSPHSKPRVVEAK
GGAGLKKPQRMPKDKSNQQALQQTVQCNLECFLFLQQPEEAERYLLLCQSSPVKSKVLDI
GAYNIVMRSWARKGNLNRIDRLFSILESTSLQPNLDSFAVALECMGRSQSPPKAILRYLQ
QLNSSGFHVDELFQKCLFEGDEKEMVLWAIRAVQPNYQLPPPPSPDISKSSLLQDFYSRE
TMVPYPKLDFSMKELQERFQQQLEMELKNTITIESVEAAKPLTPQAVKARELLGTLRSQW
HDAILQALQNSKRSMVRPKRLSKYSVLYPYLCLLPDEDYVDIMLQILNDLSPQGESLAVL
ARELGSKVYDRYIIQRKLRSCQLEKVQKIYENYIELLAKDSQPKQYLPREYWEKLVAEAG
FGPSLSLKGCSWPCVLLMRLGMHMLELLVKAVKVPRNILNHRLESKPIPVLYHVYSFYSN
WQVGLIKPHPIFSQIVSNAAETTLTFNSSAMPMLCPPVPWTSPSFGAFVLSDTKLMRFMD
ESTHHQLLLEQCPLVNLHPVLDALNQLGNCAWKINQPVLDIIISIFNDKGDEKLDIPPPL
SEAPKPPTAPGNSSTWSKTLKHELFLCKKKTAEMHSLRMDALYKLSIANYVRDKVFWFPH
NMDFRGRTYPCPPYFNHLGNDVTRAILLFAEGRPLGPRGLDWLKIHLINLTGLKKKNALQ
ERLEYANEIMEDILDSADHPLTGRKWWMDTDEPWQALACCMEIAKASRSPDPAAYISHFP
VHQDGSCNGLQHYAALGRDLSGAASVNLVPCGLPQDVYSAVAQQVEEFRRKDAERGLKIA
QVLQGFISRKVVKQTVMTVVYGVTRYGGRLQIEKRLKEIDEFPEEYLWEASHYLVKQVFN
SIKEMFSATRDIQNWLTESAKLIAQSGRTVEWVVSLGLPIMQPYYRSRSTVLNCGMQRLS
VKNSNSSQKPDTVKQKNAFPPNFIHSLDSTHMMLTALHCLRKGLTFVSVHDCYWTHALTV
DVMNQVCRQQFVALHSEKILQDLSEFMLEKYCSSSSSSTEPIAHWQKRLMEQLSNVPRTG
EFNLKQVMDSTYFFS
NT seq 3648 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctgctgaggctgcgggcggtgctgaggggcccgggcgggctcagggggcccggg
attgcgtggagaatcttcaggagctactcttctgccagcaccaaggagaaggcgaacaga
aatggcatctgtgaaagaacagagctgctggaagtgctcaaagctcgagcaaagcagctc
caaggcagtaacgtcccacaggtgacagtcagcaaagtggaactggatgcagtggacaat
gacaaataccaggaggctgtggaccctggccccaaggagaagcagcccagggcacggggt
gatggcctggcccggtccagcagctgggccacaaagttgcagaaggagatgtacatccag
cagctgaagatgaagcaggagttacccagtgctgcctcccagctagctctggagggccag
gccaagctagatgtcaaagcagaggccaaagccaaagcaaaaaccatgaagagcccgaag
atatcctggaaccagagctctggcagcccccacagcaagcccagggtggtggaagcgaag
ggaggtgcggggctgaagaaacctcagaggatgccaaaggacaagagtaaccagcaggcc
ctgcagcagacagtccagtgcaacctggagtgcttcctgttcctgcagcagcccgaggag
gccgagcgctacctcctgctgtgccagagctctccggtgaagagcaaggtgctggacatc
ggtgcctacaacatcgtgatgcgcagctgggccaggaagggcaacttgaatcgcattgac
cgtttgttttccatcctggagtccaccagcctccagcccaatctggactcctttgcagtg
gccctggagtgcatgggccggagccagtctcctcccaaagccatcttgagatatctgcag
cagctgaacagcagtggcttccatgtggatgagctcttccaaaagtgcctgtttgaggga
gatgagaaggagatggtgctgtgggccatcagggctgtccagcccaactaccagctgcct
cctccacccagccccgacatttccaagtcttctctgctccaggacttctattccagagag
acgatggtgccgtaccccaagctggatttctccatgaaggagttgcaggagcgcttccag
cagcagctggagatggagctgaagaacaccataaccattgagtcagtggaggcagccaag
cccctgaccccacaggctgtcaaagcgcgtgagctgctgggcaccctgcgctcccagtgg
cacgatgccatcctccaggccctgcagaattccaagcgcagcatggtccggcccaagagg
ctgtcaaagtacagtgtcctctacccctacctgtgcctgctgccagatgaggactacgtg
gacatcatgctgcagatcctcaatgatctgtctccacaaggtgagtccctggcagtcctg
gccagggagctgggctccaaagtctatgacaggtacatcatccagaggaagctgcgcagc
tgccagctggagaaggtgcagaagatctatgagaactacatcgagctgctggcaaaggac
agccagcccaaacagtacttgccacgggaatactgggagaagctggtggcagaagcaggc
tttgggccttccctgagcttgaagggctgcagctggccttgtgtgctcctcatgcgcctg
ggcatgcacatgctggagctcctggtgaaggctgtcaaggtgcccaggaacatcctcaat
catcgcctggagtccaagcctatccctgtcctctaccatgtctactccttctacagtaac
tggcaggtagggctgataaagccccatcccatcttctcccagattgtgtcaaacgctgca
gagaccacactgaccttcaactcctctgccatgcccatgctgtgccccccggtgccctgg
acctcccccagtttcggtgcctttgtcctcagtgacaccaagctgatgcgcttcatggat
gagagcacccaccaccagctgctcctggagcagtgtcccctggtgaacctccaccctgtg
ctggatgccctgaaccaactgggcaactgtgcctggaagatcaaccagccagtgctggat
attatcatctccattttcaatgacaaaggagatgagaagctggacatcccaccacccctc
tctgaggctcccaagcctcccactgctcctggcaattcctccacctggagcaagaccctc
aagcacgagctgttcctgtgcaagaagaagactgcggagatgcacagcctgcgcatggac
gcgctctacaagctctccatcgccaactacgtcagggacaaagtgttctggttcccccac
aacatggatttccgaggcaggacttacccgtgcccgccctatttcaaccacctgggcaac
gatgtcacccgggccatcctgctgtttgcagaggggaggccgctggggcccaggggactc
gactggctgaagatccacctcatcaacctgacggggctgaagaagaagaacgccttgcag
gagcggctggagtatgccaatgaaatcatggaggacatcctggactcggctgaccacccg
ctcacgggcaggaagtggtggatggacacagacgagccctggcaagccttggcgtgctgt
atggaaatcgccaaagcctcgaggtctccagatccagcagcctacatctctcacttccca
gttcaccaggatggctcctgcaatgggctgcagcactacgcagcgctcggccgggacctc
agcggcgctgcctccgtcaacctggtgccctgtgggctccctcaggatgtctacagtgca
gtggcccagcaggtggaggagtttcggaggaaggatgctgagcgggggttgaagattgcc
caggtgctgcagggcttcatcagccgcaaggtggtgaagcagacggtgatgacggtggtg
tacggggtcacgcgctacggcggccgcctgcagatagagaaacgcctcaaggagatcgac
gagttccctgaggagtacttgtgggaagcttctcattatctggtgaagcaggtgttcaac
agcatcaaggagatgttctcagcaactcgagatatccagaactggctgacagagagtgcc
aagctcattgcccagtcaggccggacggtggagtgggtcgtctcgctggggctccccatc
atgcagccctactatcgctccaggtccactgtgctgaattgtggcatgcagcgtttgagt
gtgaaaaactccaacagcagccagaaacctgacactgtgaagcagaagaatgcctttccc
cccaacttcatccactctctggactccacacacatgatgctcacagcactgcactgcctc
aggaagggcctgaccttcgtctcagtgcatgattgctactggacccacgcgctcaccgtg
gatgtcatgaaccaggtctgtcggcagcagttcgtggctctgcacagtgagaagattctg
caggatctgtctgagttcatgctggagaagtactgcagttcatccagctccagcacagag
cctatagcccattggcagaagagactgatggagcagctgtcaaatgttcccaggacaggt
gaattcaacctgaagcaagtgatggattccacatatttcttcagctga

DBGET integrated database retrieval system