KEGG   Ficedula albicollis (collared flycatcher): 101822266
Entry
101822266         CDS       T02815                                 

Gene name
IL4
Definition
(RefSeq) interleukin 4
  KO
K05430  interleukin 4
Organism
fab  Ficedula albicollis (collared flycatcher)
Pathway
fab04060  Cytokine-cytokine receptor interaction
fab04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:fab00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101822266 (IL4)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    101822266 (IL4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:fab04052]
    101822266 (IL4)
   00536 Glycosaminoglycan binding proteins [BR:fab00536]
    101822266 (IL4)
Cytokines and growth factors [BR:fab04052]
 Cytokines
  Interleukins
   101822266 (IL4)
Glycosaminoglycan binding proteins [BR:fab00536]
 Heparan sulfate / Haparin
  Cytokines
   101822266 (IL4)
SSDB
Motif
Pfam: IL4
Other DBs
NCBI-GeneID: 101822266
NCBI-ProteinID: XP_005053963
LinkDB
Position
13
AA seq 185 aa
MEKGDFGVQAVVWGQWGLEGEKAHTVTDHRVTQSLRAEEVQPKQAMSILVQVLLTFLVLS
ACLGDVLTLWTHTLRTNMLKESIQLLDQLQQVEVACNNMNVTNIFADYKRGNNMEILCKA
ATVAQEGQSCHKYLEGIYYNLLSLVWGSRARHKKPCPAASGSTISLKDFLKELHQVLQEE
FKSQK
NT seq 558 nt   +upstreamnt  +downstreamnt
atggagaagggggattttggggtgcaggctgtggtctgggggcagtgggggctggagggg
gaaaaagcacacacggttacagatcaccgggtgacccagagtctaagagctgaagaggtg
cagccaaagcaggccatgagcatcctggtccaggtcctgctcaccttcctggtgctgtca
gcctgcctgggtgatgtgctcaccctgtggacacacacactacggaccaacatgctgaag
gagagcatccagctgctggaccagctgcagcaggtggaggttgcctgtaacaacatgaac
gtgacaaatatttttgcagattataagagaggtaacaatatggagatcttatgcaaagct
gctacggttgctcaggagggccagagctgccacaagtacctcgagggcatttactacaac
ttgctcagcctggtctgggggagcagagcaaggcacaagaagccatgtcctgcagcatca
ggcagcaccatctcactgaaggatttcctcaaggaattacaccaagtcctccaagaagag
tttaagagtcagaagtga

DBGET integrated database retrieval system