KEGG   Ferroplasma acidarmanus: FACI_IFERC01G0118Help
Entry
FACI_IFERC01G0118 CDS       T02713                                 

Definition
(GenBank) hypothetical protein
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
fac  Ferroplasma acidarmanus
Pathway
fac00620  Pyruvate metabolism
fac00680  Methane metabolism
fac00720  Carbon fixation pathways in prokaryotes
fac01100  Metabolic pathways
fac01120  Microbial metabolism in diverse environments
fac01200  Carbon metabolism
Module
fac_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:fac00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    FACI_IFERC01G0118
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    FACI_IFERC01G0118
   00680 Methane metabolism
    FACI_IFERC01G0118
Enzymes [BR:fac01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     FACI_IFERC01G0118
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AGO60098
UniProt: S0AL56
LinkDB All DBs
Position
complement(144664..146190)
Genome map
AA seq 508 aa AA seqDB search
MIPKTMSTQHPDNALMPEWSSNKNIITNEDEIEEAYIAYKKLGIQEVMWDAEGKDVDTHV
IRKLFAKDRIFFENSKIGQDIFLTYRVPNPLIEGAERKILNETLNSIPLNYDVSNRIFNN
GIAPIFEVILPFTTDYRSMLNVVKFYEKCVVGAQSINLYDNVYSRDVTGEVLPGKINLIP
LIEDKDSIFNIEHIVKEYHRVISPEYMRIFIARSDPAMNYGMIPATLLAKYAASKMGQIS
DDTGMSVYPIIGAGSSPFRGNLGPANIKRALSEYDQYYTFSIQSAFRYDYNDQEVKDSIK
LINKHTPQKAEFIDIETEKIIKGIVGTYSERFQKIIEDIAQPINDITFYLPKRRERKLHI
GLFGYSRSTGKASLPRAISFVGALYSIGVPPEILGIASLSSLPESSQVLLKKLYRYMEQD
IKASAQYFNYESLDYLKEIWKVSDKTLDMIREDIKYVEDNIGIPTETSYNVQKHNLYTKL
LLMAFKNRKFEEVKSYIYELSLLRKFIG
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgattccaaaaacgatgtcaacccaacatcctgacaatgcattgatgccggaatggagt
tcaaataaaaatataattacaaatgaagacgaaatcgaagaagcttacatagcgtataaa
aaattaggaatacaggaggtaatgtgggatgcagaagggaaagatgtagatacacatgta
ataaggaaattatttgcaaaggaccgcattttctttgaaaatagcaaaattgggcaggat
attttcctgacataccgggttccaaatccattaattgaaggggctgaaagaaaaattctg
aatgagactctaaatagcatcccacttaattatgatgtttcaaacaggatattcaataat
ggaatagctccaatatttgaggtaatacttcccttcaccacagattacaggagcatgctg
aatgtggtcaaattttatgaaaaatgtgtggtgggagcacaatccatcaacctttatgac
aatgtttattcaagggatgttacaggggaagttcttccaggcaagattaacctgattcca
ttgatagaagataaagattcaatatttaatattgagcatattgttaaggaatatcacagg
gttatttctccagaatatatgagaatctttattgcaaggtcagatcctgcaatgaattac
gggatgatccctgcaacgttgcttgcaaaatatgcagcgtctaaaatgggccaaataagt
gatgatactggaatgtcagtatatcccataatcggagccgggtcttcaccattcagggga
aatcttggccctgcaaatataaaaagggcactttctgaatacgatcaatactatactttc
tccatacaatcagcttttagatatgattacaatgatcaggaagttaaagattcaattaaa
ttaatcaataaacatacgccacagaaagctgaatttattgatatagaaactgaaaaaata
ataaagggaattgtaggcacatattctgaaagatttcagaaaattatagaggatattgca
cagccaattaatgacataacattttaccttccgaagagaagggagcggaaattgcatata
gggctattcggatattccagaagtacaggaaaagccagtttgccacgtgcaatttccttt
gttggtgcactttattcaattggagttcccccggagatacttggaatagcttccttatcg
tccctaccggaatccagtcaggtgctgttaaagaaattataccgttatatggaacaggat
ataaaagccagtgcacaatacttcaactacgaatcacttgactatttaaaagaaatctgg
aaggttagcgataaaactctggatatgatcagggaggatattaaatatgttgaagataac
ataggcattccaaccgaaacatcatataatgtgcagaaacataatttatacactaaatta
ctgctcatggcgtttaaaaataggaaatttgaagaagttaaatcatatatttacgagctc
agcctgttaagaaaattcataggttaa

DBGET integrated database retrieval system