KEGG   Ferroplasma acidarmanus: FACI_IFERC01G0610Help
Entry
FACI_IFERC01G0610 CDS       T02713                                 

Definition
(GenBank) hypothetical protein
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
fac  Ferroplasma acidarmanus
Pathway
fac03030  DNA replication
fac03410  Base excision repair
fac03420  Nucleotide excision repair
fac03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:fac00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    FACI_IFERC01G0610
   03410 Base excision repair
    FACI_IFERC01G0610
   03420 Nucleotide excision repair
    FACI_IFERC01G0610
   03430 Mismatch repair
    FACI_IFERC01G0610
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:fac03032]
    FACI_IFERC01G0610
   03400 DNA repair and recombination proteins [BR:fac03400]
    FACI_IFERC01G0610
Enzymes [BR:fac01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     FACI_IFERC01G0610
    6.5.1.6  DNA ligase (ATP or NAD+)
     FACI_IFERC01G0610
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     FACI_IFERC01G0610
DNA replication proteins [BR:fac03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    FACI_IFERC01G0610
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     FACI_IFERC01G0610
DNA repair and recombination proteins [BR:fac03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     FACI_IFERC01G0610
   NER (nucleotide excision repair)
    Other NER factors
     FACI_IFERC01G0610
   MMR (mismatch exicision repair)
    Other MMR factors
     FACI_IFERC01G0610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase mRNA_cap_enzyme DNA_ligase_OB_2
Motif
Other DBs
NCBI-ProteinID: AGO60590
UniProt: S0AR65
LinkDB All DBs
Position
622040..623827
Genome map
AA seq 595 aa AA seqDB search
MTKSYNILYDYYLMLFSEASKKFMEMESTTKRLELTSILGSLLENAGDDLKELVYLIQGK
LAPDYEGIEFGVSGKLIVKSLAAISGMDEEEVNKLFYKNGDLGITASEIREKMEQKPLFR
EDLTVHYVYTRLMELAKSAGHGSVKGKTDIYADLMVNSYPEDIKYITRIIMGKLRLGVAD
STILDSLVHAFSSKDNADMVETAYNFHPDIGLIATLLQKGDIKAISNIGPEPLIPFKVML
AERLRSIDDIREKMNHHVSFEYKYDGLRTELHKKGDKIKIFSRGLEETTENFPDIIENFK
KSYSFESIIIDGESVPFNPDTGELFPFQMVSKRRGRKYQITEKSTEIPLVMFIFDILELN
GRTLVNLPYEERRKILEENFVDNEHFRLATRLSSDDSEEINKFFEQSIEDGCEGIVAKDT
SDESVYRAGARGWLWIKFKRDYQKELADSMDLVIIGAFNGRGRRAGAYGALLMASYNEET
HAFESVTKLGTGFSDEVLFSLPKMLSDLVRDHKPAMVESKMVPDIWIYPQIVMEIQGAEI
TVSPIHTCAFGKIEKDSGLALRFPRLIKIRDDKNAEDATTTNEIIELYKMQKKTK
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaatcttataatatactatatgattattatttaatgttattttcagaagccagc
aaaaaattcatggagatggaatcgacaacgaagaggcttgaactcacatcaatactgggt
tcattgcttgaaaatgcaggggatgacctgaaggaactggtatatttaatacagggcaag
ctggcaccggattatgagggtatagaatttggagtttcggggaagcttatagtgaaatcc
cttgcagccatatccggaatggatgaggaagaagtcaacaaattgttttacaagaatggc
gaccttggtataactgcctctgaaatcagggaaaaaatggaacagaagccacttttcagg
gaagaccttaccgtacactatgtgtatacaaggcttatggaacttgcaaaatcagcaggg
catggaagtgtaaaggggaaaacagatatttatgcggacctcatggtaaattcatatcct
gaagatataaagtatattacgagaataatcatggggaaacttagactaggcgtggcagat
tccacaatacttgattccctggtgcatgcattttcctctaaagataatgcagatatggta
gaaacagcttacaattttcatccagacatagggcttatagcaacgctcctgcagaaaggc
gatataaaggccataagcaacataggtcctgagccattgattccattcaaggtaatgctt
gcagaaaggctgaggtccattgatgatataagggaaaaaatgaaccaccacgtatcattt
gagtataaatatgacgggctcaggacagagttgcacaaaaaaggggataaaattaagatt
ttttcaagagggcttgaggaaacaactgaaaatttcccggatattatagaaaatttcaaa
aagagctattcatttgaatccataataattgatggagaatcggttccgtttaatcccgat
acaggggaattgttcccattccagatggtttccaaaaggaggggaagaaaatatcagatt
acagaaaaatccactgaaatacctcttgtaatgtttatttttgatatactggagctcaat
gggaggacacttgttaatctcccatacgaagaaaggcgtaaaattcttgaagaaaatttt
gtagataatgagcactttaggctggcaacaagattgtcctcggatgattctgaagagatt
aacaaattctttgaacagagcatagaggatgggtgtgaaggcattgttgcgaaggataca
tctgatgaatctgtttaccgtgcaggggctcgtgggtggctttggataaaatttaaaagg
gattatcagaaagaacttgcggattccatggacctggtaattatcggtgcatttaatggc
cgtggaaggagggcaggggcatacggtgcactcctcatggcatcatataacgaagaaaca
catgcattcgagtcagtcacaaaactgggaacaggattcagtgatgaggtattattttca
ttgccaaaaatgctctctgatcttgtaagagaccacaaacctgctatggttgaatcaaaa
atggttcctgacatctggatatatccacagatagttatggaaatccagggagcagaaatt
actgtaagccctatacatacatgtgcttttggaaaaatagagaaagattccggccttgcg
ttaagatttcccagattaattaaaatacgtgacgataaaaacgctgaagacgctacaact
accaatgaaattatagaactttataaaatgcagaaaaaaacaaaataa

DBGET integrated database retrieval system