KEGG   Ferroplasma acidarmanus: FACI_IFERC01G0706
Entry
FACI_IFERC01G0706 CDS       T02713                                 

Definition
(GenBank) hypothetical protein
  KO
K18128  D-glyceraldehyde dehydrogenase (NADP+) [EC:1.2.1.89]
Organism
fac  Ferroplasma acidarmanus
Pathway
fac00030  Pentose phosphate pathway
fac01100  Metabolic pathways
fac01120  Microbial metabolism in diverse environments
fac01200  Carbon metabolism
Module
fac_M00309  Non-phosphorylative Entner-Doudoroff pathway, gluconate/galactonate => glycerate
Brite
KEGG Orthology (KO) [BR:fac00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    FACI_IFERC01G0706
Enzymes [BR:fac01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.89  D-glyceraldehyde dehydrogenase (NADP+)
     FACI_IFERC01G0706
SSDB
Motif
Pfam: Aldedh LuxC Phage_integr_3
Other DBs
NCBI-ProteinID: AGO60686
UniProt: S0AP55
LinkDB
Position
716603..718084
AA seq 493 aa
MKIYIDGTWKESSNGNTLNKYNPSTGEVLDTFPAATKDDIDAAMDSAESAFPSWSDMGTQ
ERAKILYKAVELISQKRGELENLLTLEVGKIKREAIDEVDGVIDQIQYYAEFERKLTGDI
VEGSSSKRKIFQYKVPYGIVVAITPWNFPAAMVVRKLAPALLTGNTVILKPSSDTPLTAN
WIVNKFIEAGIPKGVLNFVTGRGSEIGDYIVNHKKVGLVTMTGSTSTGQKIMQNASSNMA
KLILELGGKAPFIVWKDADMIRALKSLIWAKYLNVGQSCIAAERLYIHEDIYDKFMSKFV
AITKKLTTGDPDTSDVGPLINKNALAGMVQTVNNAKDSGYKILTGGNTPDLQGKYKNGYF
FAPTIIENVPQDSGLFQDEIFGPIIGTEKISGVDEMYRKANDSKFGLASYLFTEDPELML
EASEKIRFGELYINMPGPEASQGYHTGFRMTGQAGEGSKYGINEYLKLKNVYVDYSKKAL
YINTINNSLFDNL
NT seq 1482 nt   +upstreamnt  +downstreamnt
atgaaaatatatattgatggaacatggaaagaatcatcaaatggaaatacgttaaacaag
tacaacccgagcactggagaagttcttgatacatttcccgctgccactaaagatgatatt
gatgcagctatggattccgctgaatccgcatttccctcatggtcagatatgggaacacag
gaaagggcaaaaatcctgtataaggcagtagaattaatatcgcagaaaagaggggagctt
gaaaacctgctaactttagaagttggaaaaataaaacgtgaggctatagatgaagttgat
ggtgttattgaccagattcaatactacgctgaatttgaaaggaagctaacaggagatata
gtggaagggtccagttcaaaaaggaaaatattccagtataaagttccatatggcatagtg
gttgcaataacgccatggaattttccggcagctatggttgtgagaaagcttgcaccggca
ttgttgacaggaaataccgttatactgaagccaagttcagatacaccgcttactgccaac
tggatcgtcaataaatttatagaagcaggaatacccaagggagttttgaactttgtaaca
ggccgtggatctgaaataggtgattatatagtaaaccataaaaaggtcggcctggtaact
atgacaggttcaacttcaaccgggcaaaaaatcatgcaaaatgcatcctcaaatatggca
aaattaattctggaacttggtggaaaagccccatttatcgtatggaaagatgccgatatg
ataagggcattgaaaagcctaatatgggcaaagtacctcaatgttggacaatcgtgtata
gctgcagagagattgtacatacatgaagatatatatgacaaatttatgtcaaagtttgtc
gcaatcacaaagaaattgacaacaggggatccggatacatccgatgttgggccactgata
aataaaaacgcgctggctgggatggtacagacagtaaacaatgcaaaggattccgggtat
aaaatactcacaggcggcaatactccggaccttcagggaaagtataaaaacgggtatttc
tttgcaccaaccataatagaaaacgttccacaggattccggattattccaggatgagata
tttggccctattataggcactgaaaagatttccggggtagatgagatgtatagaaaagca
aacgattcgaagtttggattggcatcttacctgttcactgaagaccctgaactcatgctg
gaggcatccgagaaaatcagattcggggaactctatataaacatgccagggcctgaagcg
tcacagggctaccatacaggatttagaatgacaggtcaggcaggagaaggcagcaaatat
ggaataaacgaatatctgaagttaaaaaatgtatatgttgattattcaaagaaggcactt
tacataaatactataaacaacagcctttttgataatctataa

DBGET integrated database retrieval system