KEGG   Fibrella aestuarina: FAES_0265Help
Entry
FAES_0265         CDS       T02429                                 

Definition
(GenBank) Thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
fae  Fibrella aestuarina
Pathway
fae00240  Pyrimidine metabolism
fae01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fae00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    FAES_0265
Enzymes [BR:fae01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     FAES_0265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK
Motif
Other DBs
NCBI-ProteinID: CCG98279
UniProt: I0K2C6
LinkDB All DBs
Position
351167..351778
Genome map
AA seq 203 aa AA seqDB search
MFIEPSRHREPPHLRTGWIEVIAGSMFSGKTEELIRRLNRARIAKLNVGIFKPSLDTRYD
VNDIVSHNASAIASTPVPQAADILPLATECDVVGIDEAQFFDPNVVHVCHQLADQGKRVI
VAGLDMDFSGKPFGCIPQLMAIAEFVTKVHAICVVCGDVAHYSYRLVPSQERVLLGETDS
YEARCRRCFNLGTEAVHREWVYE
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgttcattgaaccctcgcgccaccgggagccgcctcaccttcgcaccggatggatcgaa
gtcattgccggatcgatgttttcgggcaaaaccgaagaactcatccgccgactcaaccgg
gcgcgcattgccaagctcaacgttggtattttcaaacccagtctcgacacgcgctacgac
gtcaacgacattgtgtcgcacaatgcctcggccatcgcctcgacgcccgtgccacaagcc
gccgatatcctccccctcgctaccgaatgcgacgtggtcggcatcgacgaagcgcagttt
ttcgatccgaacgtcgtgcacgtctgccatcagctggccgatcagggcaaacgggtcatc
gtggcgggtctcgacatggacttttcgggcaaaccgtttggctgcattccccagttgatg
gccatcgctgagtttgtgaccaaagttcatgccatctgcgtggtctgcggcgacgtagcc
cattattcctatcggcttgtgccttcgcaggagcgcgtgttgcttggcgaaaccgacagc
tacgaagcccgttgccgccgctgcttcaacctcggcaccgaagccgtccaccgggaatgg
gtgtatgaatga

DBGET integrated database retrieval system