KEGG   Fibrella aestuarina: FAES_0429Help
Entry
FAES_0429         CDS       T02429                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
fae  Fibrella aestuarina
Pathway
fae00010  Glycolysis / Gluconeogenesis
fae00030  Pentose phosphate pathway
fae00051  Fructose and mannose metabolism
fae00052  Galactose metabolism
fae00680  Methane metabolism
fae01100  Metabolic pathways
fae01110  Biosynthesis of secondary metabolites
fae01120  Microbial metabolism in diverse environments
fae01130  Biosynthesis of antibiotics
fae01200  Carbon metabolism
fae01230  Biosynthesis of amino acids
fae03018  RNA degradation
Module
fae_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:fae00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FAES_0429
   00030 Pentose phosphate pathway
    FAES_0429
   00051 Fructose and mannose metabolism
    FAES_0429
   00052 Galactose metabolism
    FAES_0429
  09102 Energy metabolism
   00680 Methane metabolism
    FAES_0429
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    FAES_0429
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatase and associated proteins [BR:fae01009]
    FAES_0429
  09182 Protein families: genetic information processing
   03019 Messenger RNA Biogenesis [BR:fae03019]
    FAES_0429
Enzymes [BR:fae01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     FAES_0429
Protein phosphatases and associated proteins [BR:fae01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     FAES_0429
Messenger RNA biogenesis [BR:fae03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     FAES_0429
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: CCG98441
UniProt: I0K2T8
LinkDB All DBs
Position
complement(552114..553088)
Genome map
AA seq 324 aa AA seqDB search
MKRIAVFTSGGDAPGMNACIRAVVRGAVYHDIEVFGIRRGYNGMINGDIFQMTSHSVSNI
VQRGGTILKSARSKEFMTPEGRQRAHEQLQKFGIEGLVAIGGNGTFTGATLFFDEFGIPT
VGAPGTIDNDLYGTDYTIGFDTAVNTALEAIDKIRDTADSHDRIFLIEVMGRDSGYIAIQ
SGIAGGAELVMVPEVLTPISEVVKTLQAGFNRSKSSSIVVVAEGEEEGSAAEVAEKISKL
IEGELDMRVTTLGHIQRGGIPTAYDRILASRLGLGALEGLLNGEKNVMAGVINNELVYTP
FRDTIRLPKPINEDLLRMVKILSV
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtattgctgtgtttacctctgggggagacgcaccgggcatgaacgcctgcatt
cgggcagttgtgcgcggagccgtttaccacgatattgaagtgttcggtatccgccggggg
tataacgggatgatcaatggcgacatctttcagatgacctctcactcggtgagcaacatc
gtgcagcggggtggtaccatcctgaaatcggcccgcagcaaggagttcatgacccccgaa
gggcggcagcgcgcccacgaacaattgcagaagttcggcattgaaggtcttgtcgctatt
ggcggtaatggtacgttcaccggtgctacgctcttcttcgacgagttcggtatcccgacg
gttggtgcacccggcaccattgataacgacctctacggtactgactataccattggcttc
gacacggcggtgaacacggccctggaagccatcgataaaattcgtgatactgccgactcc
cacgaccggatcttcctgatcgaggtgatgggccgcgactcgggctatatcgctatccaa
tcggggattgcgggtggtgctgagctggtgatggtgcccgaagtgctgacgcccatctcc
gaagtcgtgaaaacgcttcaggcgggttttaaccgcagtaaatcgtcgtcgattgtagtt
gtggctgaaggcgaagaggagggaagtgccgccgaagtagccgagaaaatcagcaagctg
attgaaggcgaactggacatgcgcgtgaccaccctgggccacattcagcgcggcggtatt
ccaacggcctacgaccgcattctggcaagccggttggggctgggtgcgctggaaggccta
ctcaatggcgagaagaacgtaatggcgggtgtaatcaacaacgaactagtctacacgccg
ttccgcgacaccatccggttgcccaaaccgatcaatgaagacctgctcaggatggtgaaa
atcctgagcgtttag

DBGET integrated database retrieval system