KEGG   Fibrella aestuarina: FAES_1088Help
Entry
FAES_1088         CDS       T02429                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
fae  Fibrella aestuarina
Brite
Translation factors [BR:fae03012]
 Eukaryotic Type
  Elongation factors
   FAES_1088
 Prokaryotic Type
   FAES_1088
Mitochondrial biogenesis [BR:fae03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    FAES_1088
Exosome [BR:fae04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   FAES_1088
  Exosomal proteins of breast cancer cells
   FAES_1088
  Exosomal proteins of colorectal cancer cells
   FAES_1088
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: CCG99098
UniProt: I0K4P5
LinkDB All DBs
Position
1355957..1357144
Genome map
AA seq 395 aa AA seqDB search
MAKENFDRSKPHVNIGTIGHVDHGKTTLTAAITKVLAEKGLAAMRDFSSIDNAPEEKERG
ITINTSHVEYATANRHYAHVDCPGHADYVKNMVTGAAQMDGAILVVAATDGPMPQTREHI
LLARQVGVPQLVVFMNKVDMVDDPELLELVEMEIRELLSFYNFDGDNIPVIQGSALGGLN
GDAKWVKTIEELMDSVDSFIPLPPRQTDLPFLMPVEDVFSITGRGTVATGRIERGVINSG
EPVEILGMGAENLKSVVTGVEMFRKILDRGEAGDNVGLLLRGIEKTDIRRGMVICKPGSV
TPHAKFKAEVYVLSKEEGGRHTPFFNKYRPQFYFRTTDVTGEIVLPAGVEMVMPGDNITI
EVTLINKIAMEKGLRFAIREGGRTVGAGQVTEILD
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaggagaattttgaccgctcgaaaccgcacgtcaacatcggtacgattggtcac
gttgaccacggcaagacgacgctgacggcagccattacgaaagtactcgccgaaaaaggc
ctggctgcaatgcgggacttctcgtcgattgataatgcccctgaggaaaaagagcgtggt
atcacaatcaacacctcacacgtagaatatgcaacggctaaccgccactatgcacacgtt
gactgcccgggccacgctgactatgtgaagaacatggtaacgggtgccgctcagatggac
ggtgccatcctggtagtagctgcaaccgacggtcccatgccccagactcgtgagcacatc
ctgctcgcccgtcaagtaggtgtaccccagcttgttgtattcatgaacaaggtggatatg
gtcgacgatcccgagctgctcgaactcgttgagatggaaatccgcgagctgttgagcttc
tataacttcgacggcgacaacattcctgttatccagggttctgcactgggtggcctgaat
ggcgacgcgaagtgggtgaaaactatcgaagaactgatggactcggtagactcattcatt
cccctgcctccgcgtcagaccgatctgccgttcctgatgccggtggaagacgtattctcg
atcacgggtcgtggtacggttgctacgggtcgtatcgagcgtggtgtgatcaactcaggt
gagccggttgaaatcctcgggatgggtgccgaaaacctgaaatcagttgtaacgggtgta
gaaatgttccggaaaattctggaccgtggcgaagccggtgacaacgtaggtctgctgctc
cgtggtattgaaaaaaccgatatccgtcgtggtatggttatttgcaagcctggttcagta
acgccccatgccaaattcaaggctgaggtgtacgtactgtcgaaagaagaaggtggccgt
cacacgccgttcttcaacaagtaccgtccgcagttctacttccgtaccacggacgtaacg
ggcgaaatcgtactgcctgctggcgttgagatggtaatgcctggtgataacatcaccatc
gaagttaccctgatcaacaaaatcgccatggagaaaggtcttcgcttcgctattcgtgaa
ggtggccgtaccgtaggtgctggtcaggtaaccgaaatcctcgactaa

DBGET integrated database retrieval system