KEGG   Fibrella aestuarina: FAES_2420Help
Entry
FAES_2420         CDS       T02429                                 

Definition
(GenBank) alcohol dehydrogenase GroES domain protein
Organism
fae  Fibrella aestuarina
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C HI0933_like FAD_binding_3 3HCDH_N FAD_binding_2 Pyr_redox_2 Pyr_redox_3 ADH_zinc_N_2 UDPG_MGDP_dh_N Pyr_redox DAO TrkA_N 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: CCH00429
UniProt: I0K8H6
LinkDB All DBs
Position
3020560..3021573
Genome map
AA seq 337 aa AA seqDB search
MKALQFTGNKSFDLQDVDVQPPLPGEVRLKVAYCGVCGTDVHIYHGAMAQRLSLPQVIGH
EVSAEIDAVGEGVTGWQPGDRVTVRPLKPGKEMPIDNGVQHIGQNLKFIGIDAPGGMQQY
WNVPAYTLHRLPDNLPLTIGAMVEPLAVACHDVRLGEVKTGENVVIIGGGPIGMLIALVT
KQKGANVLISEVNEARLQLAKSMGLATVNPKETDLLAHVEDFTNGAMADVVFEVSGVQAG
VAVMTQLPRVRGRIVMVAIHAEPKAVDLFRFFWRELKLIGARVYEPEDFEEAISLAASNT
LPLDKLITQVVPLTDAQNVFEAIDQNPAGMKYLLDIQ
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctctccagtttaccggtaacaaatcatttgatctgcaggacgttgacgtgcag
ccgccattgcccggtgaggtccgcctgaaagtggcctactgtggcgtatgcggcaccgac
gtgcatatttaccacggcgctatggcccagcggctcagcctgccgcaagtcattggccac
gaagtatcggccgagatcgatgcggttggcgaaggggttaccggctggcaacccggcgac
cgcgtgacggttcggccgctgaaaccaggtaaggaaatgcccattgacaacggcgttcaa
catatcggacagaacctgaaattcatcggtatcgacgcccctggcggtatgcaacaatac
tggaacgtacctgcgtatacattacaccggttgcccgacaacctgcccctgacgattggt
gctatggttgagccgctggcggtggcctgtcacgatgtacggctgggcgaggtaaaaacg
ggcgagaacgtcgtcattatcggtggagggccaatcgggatgcttattgcgctggtgact
aaacagaaaggggccaacgtcctgatctcggaagttaacgaagcgcggctccaactcgct
aagtcgatggggctggcgacagtcaaccccaaagagaccgatctgctcgcccatgtagag
gattttaccaacggggccatggctgatgtcgtctttgaggtatcgggtgtgcaagccggg
gttgccgtaatgacccagttaccccgagtacgtggccgaattgtaatggtcgccatccat
gccgaacctaaagccgtcgacctgttccgctttttctggcgcgagttaaaattgattggt
gctcgggtttacgaaccagaagattttgaggaagccatttcgctggctgcgtcaaatacg
ttgccactcgataagcttattacgcaggtggtcccgctaaccgatgcccaaaacgtgttc
gaggctattgaccagaacccggcgggcatgaaatacttgttagacattcaataa

DBGET integrated database retrieval system