KEGG   Fibrella aestuarina: FAES_2573Help
Entry
FAES_2573         CDS       T02429                                 

Definition
(GenBank) D-alanine-D-alanine ligase domain protein
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
fae  Fibrella aestuarina
Pathway
fae00473  D-Alanine metabolism
fae00550  Peptidoglycan biosynthesis
fae01100  Metabolic pathways
fae01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:fae00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    FAES_2573
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    FAES_2573
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    FAES_2573
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:fae01011]
    FAES_2573
Enzymes [BR:fae01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     FAES_2573
Peptidoglycan biosynthesis and degradation proteins [BR:fae01011]
 Precursor biosynthesis
  Amino acid ligase
   FAES_2573
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp ATP-grasp_4 CPSase_L_D2
Motif
Other DBs
NCBI-ProteinID: CCH00582
UniProt: I0K8X9
LinkDB All DBs
Position
3194830..3196482
Genome map
AA seq 550 aa AA seqDB search
MRIGIFFGGPSRERDVSFSGGRTALANLNKALFEPVLVFVSGLGDFYIVEPDFLENESIR
AALPEQEGFSVYDESLPDGDEFIPGQPIGPEFFEAYFDLAFLAMHGPDCEDGAIQGLLEW
HKMPYTGPGIMGSGLGINKILQNHLIALVTGQQKKTATIGRDAWLLADQGAYFSSLIEHL
GLPIVVKAPHQGSSIGVAIVRENDLGTFQKAVNQCFFTAQLSLAEWEGMDDVAKREYAQR
MANLSATIGYPMVIEETGEYIGGPVELIQTLNDYADSSETETLTLASINAEDELLFEEFI
NGQEFSCGVIQDDDGRAIALPPTEIYNATAFDYETKYLSSEAKKRIPVATSLENNRAIQL
AVETVFSKLGINVYSRIDGFLTPDRDGEPGRVLLHDPNTIPGMSPTSLIFKQMAEIGMNL
SDSLTYLIRQSLRERIRTGKDTFRLKQMLADLDERLADRKAADLPEQAIPFGPSDDEWTM
ARARYNDAVALGETRPQLVYAKSDTETYNVPVYCLFKDSIAELEQALAGPRHPLLDETTE
RTRHITGKYV
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atgcgtatcggaattttctttggcgggccttcgcgggagcgcgacgtatctttttctggc
gggcgcacggcgctggccaacctgaataaagccctgtttgagcccgtgctggtgtttgtc
agcgggttgggtgacttctacattgtcgagcccgattttctggagaacgagtcgatccgg
gcggcgctgcccgagcaggagggcttctcggtctacgatgaatcattacccgatggcgac
gaattcattccggggcaacccatcggtcccgagtttttcgaagcctacttcgacctggcg
tttctggccatgcacggtcccgattgcgaagacggcgccattcaggggctgctcgaatgg
cacaagatgccctacaccgggccggggattatgggttctgggctgggtatcaacaagatc
ctgcaaaaccacctgattgcgctggtcaccgggcagcagaaaaagacggccaccattggc
cgtgatgcctggcttctggcggaccagggggcgtatttctcgtcgttgatcgagcacctg
gggctgcccatcgtggtcaaggcaccgcatcaggggtcgagcatcggcgtagccattgtg
cgcgaaaacgacctgggtacgttccagaaggccgttaaccagtgtttcttcacggcgcag
ctatcactggcggaatgggaggggatggacgacgtcgccaagcgcgaatacgcccagcgc
atggccaacctcagcgcgacgattggttacccgatggtgatcgaagaaacgggcgagtat
attggcgggccggtcgagctcatccagacgctgaatgattacgccgacagctcggagacc
gaaacgctgacgctggcttcgatcaacgcggaagacgaactgctcttcgaagagtttatt
aacggacaggagttctcctgtggcgtgattcaggacgacgacggacgggccattgccctg
ccgcccaccgagatctacaacgctacggccttcgactacgagaccaaatacctcagcagc
gaagctaaaaagcggattccggtcgccacgagcctggaaaacaaccgagccatccaactg
gcggtcgaaacggtgttttctaaattggggatcaacgtctattcgcgcatcgacggcttc
ctgacgcccgaccgcgacggcgagccgggccgcgtgttgctgcacgaccccaatacgatt
ccgggtatgtcgccgacatcgctgattttcaagcaaatggccgaaatcggcatgaacctg
agcgactcgctcacgtacctgatccggcagtcgttgcgcgaacgtatccgcacgggtaaa
gacaccttccgcctgaagcagatgctcgccgatctcgacgaacgccttgccgatcggaaa
gccgccgatttgcccgaacaggcgattccgtttggcccgtcggacgacgagtggacaatg
gcccgtgcccgctataatgatgccgtcgccctgggcgaaacccggccgcaactggtctac
gccaaatcggatactgagacatacaacgtacccgtttactgcctcttcaaagacagcatc
gccgaattggagcaggcgctggcaggcccccggcatccgctactcgacgaaaccaccgaa
cgtacccggcatatcacaggaaaatacgtataa

DBGET integrated database retrieval system