KEGG   Fibrella aestuarina: FAES_3414Help
Entry
FAES_3414         CDS       T02429                                 

Gene name
treS3
Definition
(GenBank) maltose alpha-D-glucosyltransferase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
fae  Fibrella aestuarina
Pathway
fae00500  Starch and sucrose metabolism
fae01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fae00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    FAES_3414 (treS3)
Enzymes [BR:fae01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     FAES_3414 (treS3)
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     FAES_3414 (treS3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase hDGE_amylase DUF3459
Motif
Other DBs
NCBI-ProteinID: CCH01422
UniProt: I0KBB9
LinkDB All DBs
Position
4224589..4226361
Genome map
AA seq 590 aa AA seqDB search
MRRVLLTLLLPLLLPTYKATGQPRPTDFIQELWYKKGVVYNLDVKVFQDSDGDGVGDFNG
LTRRLDYLSDLGVTVLWLAPFQPSPNQDDGYDISDFYGIDARLGTQADLRNFIQQAKKRG
IRVVMDLVVNHTSSQHPWFQQARRNKESPYRSWYVWSQQRPRDWNKGMIFPGVQHETWSY
DSLAGAYFYHRFYRFQPDLNAQNPAVQAELRNVVRHWLALGIDGFRLDAVPFFIEVPGTS
VNNPDLQFDLLMWLRQFIQWQKGDALLLGETNVAPKENKQYFGQYGEGMQMMFNFYVNQF
LFYALATGDVGTLEKALEATRDVPTTAQWAFFLRNHDEIDLGRLSKRQREAVYARMGPDK
NMQLYERGIRRRLAPMLANPAQLRMAYSLLFALPGTPVLRYGEEIGMGDDLRLKERLAIR
TPMQWLAGPNGGFTTARQPIRPPIQQGPYRYANVNVTAQRQDSASLLTHIRRLIRLRKQY
PEIGQGVWQLRKSHSPHVLILASEGPNRTVVTVHNFSPHPQTIRGLFEGARGARGIGING
KTGPSPIDKTGDIQLPGYGYGWFTIEPKTNPVPPDGKSTSGRATPTGRGR
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcgtgtgttactgaccctgctgcttcctcttcttctaccaacctacaaagcgacg
gggcaaccgcggccgaccgactttatccaggaattatggtataaaaaaggcgtcgtttat
aacctcgatgtcaaggtattccaggattcggacggtgatggcgtgggcgatttcaacggc
ctgacccgacggctggattacctcagcgacctgggcgtaaccgttctctggctcgcgcct
ttccagcccagccccaaccaggacgacggctatgacatcagtgatttctacggcatcgat
gcccgcctgggcacgcaggcggacctcaggaatttcattcaacaagccaaaaagcggggc
attcgcgtcgtgatggacctagtggtcaatcacacctccagccagcacccctggtttcag
caggcccggcgcaacaaagagtcgccttaccgttcctggtatgtctggtcgcaacaacgg
ccccgcgactggaacaagggcatgattttccccggcgttcagcacgaaacgtggagctac
gactcgctggcgggggcctacttttatcaccgtttctaccgctttcagcccgacctcaac
gcccagaatccggccgtgcaagccgagttgcgcaacgtcgttcggcattggctcgcgctg
ggtatcgacgggttccggctcgatgcggtgccttttttcattgaagtacccggcacgtcc
gtcaataacccggaccttcagttcgatttgctgatgtggctgcggcagttcatccagtgg
cagaaaggcgatgcgctgctgctgggcgagaccaatgtggccccgaaggaaaacaagcag
tatttcgggcagtacggcgaaggcatgcagatgatgttcaacttctacgtcaaccagttt
ctgttctacgccctggcaacgggcgacgtcggaacactggaaaaagcactggaagctacc
agggacgtacccacgacggcccaatgggccttctttctgcgtaaccacgacgagatcgac
ctcggccgactcagcaaacgccaacgcgaggcggtgtatgcccgtatggggccggacaaa
aacatgcagctttatgagcggggtatccgccgacggctggccccgatgctggccaacccc
gctcaactgcggatggcgtatagcctgctgttcgccctgccgggcacgccggtgttgcgc
tacggcgaagaaatcggcatgggtgatgacctccggttgaaagaacggctcgccatccgc
acgcctatgcagtggctggccggaccgaacggcgggtttacgaccgcccgccaaccgata
cgtccgccgattcagcaaggcccctataggtacgccaatgtgaatgtaaccgcccagcgg
caggattcggcgtcgttactgacgcacatccgacggctgattcgactgcggaagcagtac
cccgaaatcggtcagggcgtttggcagctgcgaaaaagccattcgccacacgtgctgatc
ctggccagcgaaggtcccaaccggacggtggtgacggttcataatttcagcccgcatcca
caaaccatccgggggctttttgaaggggcaaggggagcccggggcatcgggataaacgga
aaaacagggccatcgccgatcgacaaaacgggggatatccagctaccgggctacggctac
ggctggtttaccatcgaaccaaaaaccaacccagtgccgccagacgggaagtctacctcg
ggcagagcaacccctaccggacgaggacgatga

DBGET integrated database retrieval system