KEGG   Fibrella aestuarina: FAES_5341Help
Entry
FAES_5341         CDS       T02429                                 

Gene name
amyS
Definition
(GenBank) cytoplasmic alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
fae  Fibrella aestuarina
Pathway
fae00500  Starch and sucrose metabolism
fae01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fae00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    FAES_5341 (amyS)
Enzymes [BR:fae01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     FAES_5341 (amyS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase DUF1939 Glyco_hydro_70
Motif
Other DBs
NCBI-ProteinID: CCH03340
UniProt: I0KGT7
LinkDB All DBs
Position
6566322..6567806
Genome map
AA seq 494 aa AA seqDB search
MRVALSGVTLLGTIGLFLTSCEPQVAPEFQPKVSNARAAAPVVNGVMMQGFYWNVPKTTT
AGTWWQNLAAKATELQTAGITALWIPPAYKGGSVDDVGYGVYDRYDLGEFNQKGTVATRY
GTLAQLQSAITVLHSKNIQVYEDMVMNHLTWADYTENRNNENIYTGFSYPGRNNTYSAYK
WNATLFSGYQRGDGSWNQWQPWDFASYNNGDAYDNLLGCEIKYNNGVGSNSAANETITWG
NWITTKLGLDGYRLDATKHIYTPFLNNWLDQVKTTSRFAVSEAWFNNVQWLQDYAAATGG
RTSLFDVPLHYTFVNMSNGNGAWDMRGLAFAGFTEANGSLSVSFVDNHDTDAPSGGLRSP
VVNLKMLAYAYILTRDKGYPCVFYRDYYEYGLGAQIKKLIDIRKANGYGSGYEYTSVNDA
DVYVYSRAGDTTHKGMLVMLNDGSGASTKGVTTPFKNATLTDKTGNRTGTVTTNASGFGS
FPVNGRSYSVWVPN
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgagagtcgcactttcaggagtaaccctattaggaacaataggcctgtttctaacgtct
tgcgaaccacaggtcgcgcccgagtttcaacccaaggtaagtaacgcacgcgctgctgcg
ccagtcgtcaatggcgtgatgatgcagggcttctattggaacgtacccaaaacgaccacg
gccggtacgtggtggcaaaacctggcagccaaagccaccgagcttcaaacagccggtatc
acggccctctggattccgcctgcttacaagggcgggagcgtcgacgatgttggctatggc
gtgtatgatcgctacgacctgggcgaattcaaccagaaaggtacggtagctacccgctat
ggaacattggctcagcttcaatcggccattacggtgctgcacagcaagaacattcaggtc
tatgaagacatggtgatgaaccacctgacctgggctgattatacggaaaaccgcaacaat
gagaatatctatacgggcttctcttatccaggccgcaacaatacatacagcgcttataag
tggaatgctacgctcttcagcgggtaccagcgcggcgacggctcctggaatcagtggcag
ccctgggattttgcctcgtataacaacggcgatgcctacgacaatttgctgggctgcgaa
atcaagtacaacaacggggtcggcagtaattcggcagctaacgagaccattacctggggc
aactggatcaccaccaagctgggcctcgacggataccggctcgatgccacaaaacacatc
tacacgcctttcctgaacaactggctcgatcaggtgaaaaccacatcccgcttcgccgtc
tcggaagcctggttcaataatgtgcagtggctacaggattacgccgccgctacgggtggg
cgcaccagcctgttcgacgtaccgctccactacacgtttgtgaacatgagcaacggcaat
ggggcctgggatatgcgggggctggccttcgcggggttcaccgaagccaatggctcgcta
tcggtctcgtttgttgacaaccacgataccgatgcgccttccggtgggctgcgctcgccg
gtggttaacctgaaaatgctggcctacgcctacatcttgacccgcgacaaagggtatccc
tgcgtgttctaccgcgattattacgagtatgggctgggcgcacagatcaaaaagctgatc
gacattcggaaggccaatggctacggatcgggttacgagtacaccagcgtaaacgacgcc
gacgtctatgtgtactcgcgggcgggcgatacgacccacaagggcatgctcgtcatgctg
aacgacggcagcggcgccagcacaaaaggcgtaacaacccccttcaaaaacgcaacactg
accgacaaaaccggcaaccgtaccggcacggtaaccaccaacgccagcggttttggtagc
ttccccgtcaatggccgtagttattcggtctgggtaccgaattga

DBGET integrated database retrieval system